Lus10036551 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61113 152 / 7e-50 Ubiquitin related modifier 1 (.1)
AT2G45695 142 / 1e-45 Ubiquitin related modifier 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041378 170 / 8e-57 AT3G61113 179 / 2e-60 Ubiquitin related modifier 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G078200 143 / 6e-46 AT3G61113 141 / 2e-45 Ubiquitin related modifier 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Representative CDS sequence
>Lus10036551 pacid=23174440 polypeptide=Lus10036551 locus=Lus10036551.g ID=Lus10036551.BGIv1.0 annot-version=v1.0
ATGCAACTCACTCTTGAATTCGGTGGAGGGCTGGAGCTTCTTTGTGATTCAGTAAAGATACATCAAGCCAACGTGGATCTGGAAAATGAGTCACAGAAGT
TAACGATGAAAGATTTGCTGGCTTGGGGCCGTACCAATTTGATCAAGGAGAGGCCTGAGATGTTCATGAAAGGAGATACCGTGAGGCCTGGTGTTCTAGT
TCTGGTGAACGACTGTGATTGGGAGCTGAGTGGGCAGCTTGACACGACTCTGCAAGAGAAAGACGTGGTGGTTTTCATTTCCACCTTGCATGGTGGCTAG
AA sequence
>Lus10036551 pacid=23174440 polypeptide=Lus10036551 locus=Lus10036551.g ID=Lus10036551.BGIv1.0 annot-version=v1.0
MQLTLEFGGGLELLCDSVKIHQANVDLENESQKLTMKDLLAWGRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLQEKDVVVFISTLHGG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61113 Ubiquitin related modifier 1 (... Lus10036551 0 1
AT5G58920 unknown protein Lus10040699 1.4 0.8944
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030906 2.0 0.9012
AT3G11591 unknown protein Lus10016986 2.8 0.8740
AT2G37195 unknown protein Lus10023187 3.2 0.8708
AT1G52740 HTA9 histone H2A protein 9 (.1) Lus10019447 3.2 0.8842
AT4G14965 ATMAPR4 membrane-associated progestero... Lus10042022 3.5 0.8884
AT1G63460 ATGPX8 glutathione peroxidase 8 (.1) Lus10008023 5.7 0.8706
AT5G27720 LSM4, EMB1644 SM-like protein 4, embryo defe... Lus10029426 6.5 0.8940
AT5G22875 unknown protein Lus10037369 7.7 0.8486
AT1G71430 unknown protein Lus10007091 8.2 0.8474

Lus10036551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.