Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041371 [exp] 120 / 7e-36 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G076702 [exp] 62 / 2e-12 AT5G19790 74 / 5e-15 related to AP2 11 (.1) Potri.002G153500 [exp] 61 / 1e-11 AT5G19790 79 / 6e-17 related to AP2 11 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036557 pacid=23174389 polypeptide=Lus10036557 locus=Lus10036557.g ID=Lus10036557.BGIv1.0 annot-version=v1.0 ATGAAGAGCATCGAGAAATCCGTGGAGCCGAGCATAATCGTGCCGTCTTCAGGGGGGGAGGAGCAGAGCTATTTGGTGGAGCCGGCAGGGAATTGCTCGT GGGAGACGTCAAGTGTGTCGGATTGCAGTAATGAGTGGGTTGGGTTCCGGCAGCCGGCGGCGGGTATGGATTTTTCCTCCGACGGGTCGGATTGCAGCGG CGATCATTACGGGATGTCGGGTCAAATGGTGGGGAATTGGAATTGGATCGATAGTCCTGAGGTTTCGTTCGCGGAGAGTATTATTAGCTCAGAGGAGGAA TCGAGGAGTAAGAGGTTTAAGGTTTCTTCCTCTGTTGCCATCCCTCCGCCATCGTCGTCGTTCTCACCTTGGTCGTATCACAGCGATAGCTGA
AA sequence Show only first row Show all	>Lus10036557 pacid=23174389 polypeptide=Lus10036557 locus=Lus10036557.g ID=Lus10036557.BGIv1.0 annot-version=v1.0 MKSIEKSVEPSIIVPSSGGEEQSYLVEPAGNCSWETSSVSDCSNEWVGFRQPAAGMDFSSDGSDCSGDHYGMSGQMVGNWNWIDSPEVSFAESIISSEEE SRSKRFKVSSSVAIPPPSSSFSPWSYHSDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036557 [exp]	0	1
					Lus10042011 [exp]	1.7	0.9523
AT1G61800		ATGPT2, GPT2	ARABIDOPSIS GLUCOSE-6-PHOSPHAT...		Lus10007653 [exp]	2.4	0.9388
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10019675 [exp]	5.0	0.9122
AT1G67330			Protein of unknown function (D...		Lus10037026 [exp]	7.5	0.9054
AT3G20898			unknown protein		Lus10014904 [exp]	8.5	0.8824
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10036556 [exp]	9.0	0.8753
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Lus10023418 [exp]	9.3	0.9174
AT2G38600			HAD superfamily, subfamily III...		Lus10017060 [exp]	10.2	0.9093
AT3G11690			unknown protein		Lus10021243 [exp]	11.5	0.8936
AT2G28790			Pathogenesis-related thaumatin...		Lus10040843 [exp]	11.5	0.9104

Compare expression of checked genes

Lus10036557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.