Lus10036579 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27970 84 / 4e-21 CKS2 CDK-subunit 2 (.1)
AT2G27960 78 / 2e-18 CKS1AT, CKS1 cyclin-dependent kinase-subunit 1 (.1)
AT1G08170 76 / 2e-16 Histone superfamily protein (.1)
AT2G37470 63 / 3e-12 Histone superfamily protein (.1)
AT3G53650 62 / 3e-12 Histone superfamily protein (.1)
AT2G28720 62 / 6e-12 Histone superfamily protein (.1)
AT5G59910 62 / 9e-12 HTB4 Histone superfamily protein (.1)
AT3G45980 61 / 2e-11 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT1G07790 61 / 2e-11 HTB1 Histone superfamily protein (.1)
AT3G46030 60 / 2e-11 HTB11 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041351 223 / 3e-73 AT1G08170 139 / 8e-41 Histone superfamily protein (.1)
Lus10041349 102 / 3e-27 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1)
Lus10021405 84 / 1e-20 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1)
Lus10016159 84 / 1e-20 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1)
Lus10023753 61 / 1e-11 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10017456 60 / 4e-11 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10005897 60 / 5e-11 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 60 / 5e-11 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 60 / 5e-11 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G004000 91 / 1e-23 AT2G27960 166 / 2e-55 cyclin-dependent kinase-subunit 1 (.1)
Potri.004G217500 90 / 3e-23 AT2G27970 152 / 3e-50 CDK-subunit 2 (.1)
Potri.001G212200 73 / 6e-16 AT1G08170 129 / 1e-37 Histone superfamily protein (.1)
Potri.010G230701 61 / 1e-11 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030500 61 / 2e-11 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G030400 61 / 2e-11 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.017G123700 60 / 3e-11 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 60 / 4e-11 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.008G029900 60 / 4e-11 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.010G231300 60 / 4e-11 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
CL0012 PF01111 CKS Cyclin-dependent kinase regulatory subunit
Representative CDS sequence
>Lus10036579 pacid=23174633 polypeptide=Lus10036579 locus=Lus10036579.g ID=Lus10036579.BGIv1.0 annot-version=v1.0
ATGGCACCGAGGCGGCGGTCGACGGGGAGAGTGGTCGGAGTGCTTCGATCAACGAGGAAAGTGGTCAAGGAAACTGTTGAAGTCTCCATTCTTGATGGCG
ACACCCAGGAGACTTCGACTCCGGCAGACATCAACCTTTTGGACACCAAAGAGTTAATTGACGTCGTTACCCCCACCGAAGCAGGACAAGAAGACACAAC
CACCAACTCCACCACCTCCACCGTGAGAACCATCCCCGTGGAGGACGCTGGACCGGAACGGAAGGAAGAACAAGTCATGAGTGAAGATCATGATAAATTC
GAAGAGACACAAAAGGAAGCAGAGAAGGAAGTACCAAGAAAGGAAGAAAAGAAAGCACCGGCGGAAAAGGACAAAAAGGTAAATAAGAAGAAGAGAAAGA
GCCGATTTGTGGAAGGAGGGGAAGGGTACAGGAGGTACGTGTACAAGGTGATGAAGCAGGTGCATCCAGATATGAAGATATCCGGGGTTGCTATGAGCAT
CATCAACAGTTTGATGAAGGACATGTTTGAGCGAATTGCTGACGAGGCTGCCACGCTGTCTCTGTGTGTGATTTTGGATTCGTTTCTGCAGAACGAATGG
CGTGCAATAGGTGTTCAGCAGAGCCGAGGGTGGATCCACTACGCTATCCATCGACCTGAGCCACACATCATGCTTTTCAGGAGGCCTCTCAACTATGAAC
AGCAGCAAGCGAAAGAGAACCAAGCTCTGTAG
AA sequence
>Lus10036579 pacid=23174633 polypeptide=Lus10036579 locus=Lus10036579.g ID=Lus10036579.BGIv1.0 annot-version=v1.0
MAPRRRSTGRVVGVLRSTRKVVKETVEVSILDGDTQETSTPADINLLDTKELIDVVTPTEAGQEDTTTNSTTSTVRTIPVEDAGPERKEEQVMSEDHDKF
EETQKEAEKEVPRKEEKKAPAEKDKKVNKKKRKSRFVEGGEGYRRYVYKVMKQVHPDMKISGVAMSIINSLMKDMFERIADEAATLSLCVILDSFLQNEW
RAIGVQQSRGWIHYAIHRPEPHIMLFRRPLNYEQQQAKENQAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10036579 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011979 3.5 0.9691
AT5G03860 MLS malate synthase (.1.2) Lus10020565 6.7 0.9603
AT1G12780 ATUGE1, UGE1 A. THALIANA UDP-GLC 4-EPIMERAS... Lus10029572 8.1 0.9659
AT5G45690 Protein of unknown function (D... Lus10005416 10.4 0.9467
AT2G05910 Protein of unknown function (D... Lus10033432 10.4 0.9590
AT1G67910 unknown protein Lus10023632 11.3 0.9496
AT4G26400 RING/U-box superfamily protein... Lus10043027 11.6 0.9568
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10039830 12.6 0.9395
AT3G21510 ATHP3, AHP1 histidine-containing phosphotr... Lus10002256 13.9 0.9383
AT3G46130 MYB PFG3, ATMYB111 ... myb domain protein 48 (.1.2.3.... Lus10005886 14.7 0.9500

Lus10036579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.