Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50960 99 / 2e-26 ATNBP35, NBP35 nucleotide binding protein 35 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027463 [exp] 140 / 7e-42 AT5G50960 573 / 0.0 nucleotide binding protein 35 (.1) Lus10039219 [exp] 139 / 2e-41 AT5G50960 566 / 0.0 nucleotide binding protein 35 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G336900 [exp] 113 / 6e-32 AT5G50960 571 / 0.0 nucleotide binding protein 35 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036588 pacid=23174368 polypeptide=Lus10036588 locus=Lus10036588.g ID=Lus10036588.BGIv1.0 annot-version=v1.0 ATGCTCAACTCGGTTGCGCACACTGTGGTGTTTGACAGCAGTGCCGGTGGGGCCGCATCAATGTGTAGGGAAATGGGGGTTCCGTTTATGGGGAAGGTAC TGCTCGATCCGCAGCTTTGTAAGGTAGCTGAAGAAGGTCGATCATGTTTTGCTGATCAGAGATGCAACCTAAGTGGTCCTGCACTCAAGGGTATGATTGA GAAACTAATCGAGGCAAAACAGTGGAATCAGCAAAACTCGCTGCACAATAAGCAGTAA
AA sequence Show only first row Show all	>Lus10036588 pacid=23174368 polypeptide=Lus10036588 locus=Lus10036588.g ID=Lus10036588.BGIv1.0 annot-version=v1.0 MLNSVAHTVVFDSSAGGAASMCREMGVPFMGKVLLDPQLCKVAEEGRSCFADQRCNLSGPALKGMIEKLIEAKQWNQQNSLHNKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50960		ATNBP35, NBP35	nucleotide binding protein 35 ...		Lus10036588 [exp]	0	1
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10006697 [exp]	3.5	0.8069
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	6.3	0.7950
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	12.0	0.7811
AT5G56820			F-box/RNI-like/FBD-like domain...		Lus10039271 [exp]	12.4	0.5665
AT2G13980			Polynucleotidyl transferase, r...		Lus10011601 [exp]	13.4	0.7367
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	13.9	0.7811
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Lus10024006 [exp]	15.5	0.5434
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	15.5	0.7811
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020333 [exp]	15.7	0.7569
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	16.8	0.7770

Compare expression of checked genes

Lus10036588 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.