Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28088 116 / 5e-36 Low temperature and salt responsive protein family (.1) AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2) AT2G24040 112 / 2e-34 Low temperature and salt responsive protein family (.1) AT4G30650 96 / 7e-28 Low temperature and salt responsive protein family (.1) AT2G38905 66 / 2e-16 Low temperature and salt responsive protein family (.1) AT3G05880 66 / 2e-16 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 66 / 4e-16 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT1G57550 50 / 6e-10 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035809 [exp] 145 / 9e-48 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2) Lus10040370 [exp] 66 / 3e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 66 / 3e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 64 / 2e-15 ND 89 / 1e-25 Lus10029450 [exp] 64 / 2e-15 ND 87 / 6e-25 Lus10005948 [exp] 63 / 2e-14 ND 85 / 5e-23 Lus10019890 [exp] 60 / 7e-14 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 60 / 8e-14 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G182500 [exp] 126 / 6e-40 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 108 / 6e-33 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 67 / 7e-17 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 66 / 2e-16 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 65 / 7e-16 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 62 / 6e-15 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 62 / 1e-14 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10036592 pacid=23174523 polypeptide=Lus10036592 locus=Lus10036592.g ID=Lus10036592.BGIv1.0 annot-version=v1.0 ATGCCGAGCAGCTGTGCCATCTTCTGCGAGATCCTCATCGCAATCTTGCTCCCTCCTCTGGGAGTCTGCCTCAGGCATGGCTGCTGTACAGTGGAGTTCT GCATCTGCGTGCTGCTGACGATTCTCGGATACCTTCCTGGAATAATCTATGCGCTCTATGCGATTGTGTTCATCGATCGTGACGAGTTCTTCGACGAGTC TAGGCGTCCTCTCTATTCCTCTTACTAG
AA sequence Show only first row Show all	>Lus10036592 pacid=23174523 polypeptide=Lus10036592 locus=Lus10036592.g ID=Lus10036592.BGIv1.0 annot-version=v1.0 MPSSCAIFCEILIAILLPPLGVCLRHGCCTVEFCICVLLTILGYLPGIIYALYAIVFIDRDEFFDESRRPLYSSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30660			Low temperature and salt respo...		Lus10036592 [exp]	0	1
AT1G04280			P-loop containing nucleoside t...		Lus10022217 [exp]	2.8	0.7435
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Lus10020357 [exp]	3.9	0.7400
AT1G67623			F-box family protein (.1)		Lus10038709 [exp]	4.5	0.7405
AT5G05670			signal recognition particle bi...		Lus10030593 [exp]	6.3	0.7398
AT5G66530			Galactose mutarotase-like supe...		Lus10041758 [exp]	8.9	0.7267
AT1G06050			Protein of unknown function (D...		Lus10008154 [exp]	13.0	0.7034
AT3G58140			phenylalanyl-tRNA synthetase c...		Lus10028547 [exp]	16.9	0.6779
AT2G35130			Tetratricopeptide repeat (TPR)...		Lus10018318 [exp]	17.3	0.6931
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10043137 [exp]	19.6	0.6599
AT5G49720		TSD1, IRX2, DEC...	TUMOROUS SHOOT DEVELOPMENT 1, ...		Lus10026275 [exp]	22.2	0.6811

Compare expression of checked genes

Lus10036592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.