Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035810 [exp] 96 / 1e-26 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G104600 [exp] 37 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036593 pacid=23174447 polypeptide=Lus10036593 locus=Lus10036593.g ID=Lus10036593.BGIv1.0 annot-version=v1.0 ATGGGAGAGGACAAGAAGCAGGTGCTTATGCTCTCTTCTGCCGTGGAAAACCGTGCAGGGGGATTCTATGCCGGTGGAGATCTCCTCCGTCCACGAACCG GCAGCAAGAAGAATGCGGCACCGGCCTCCTCCATGATAACGTCTTCCCCTCCTTACCTCTTCCCTACACGATTCATGCTTCCTGTAGGGATGTCCATCAT CATCCTCATGTACTTGTAG
AA sequence Show only first row Show all	>Lus10036593 pacid=23174447 polypeptide=Lus10036593 locus=Lus10036593.g ID=Lus10036593.BGIv1.0 annot-version=v1.0 MGEDKKQVLMLSSAVENRAGGFYAGGDLLRPRTGSKKNAAPASSMITSSPPYLFPTRFMLPVGMSIIILMYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036593 [exp]	0	1
AT3G59110			Protein kinase superfamily pro...		Lus10001423 [exp]	1.4	0.8979
AT4G24015			RING/U-box superfamily protein...		Lus10032418 [exp]	2.4	0.8905
AT2G20680		MAN2, AtMAN2	endo-beta-mannase 2, Glycosyl ...		Lus10039833 [exp]	4.0	0.8931
AT5G67350			unknown protein		Lus10010401 [exp]	6.5	0.8884
AT3G59110			Protein kinase superfamily pro...		Lus10001055 [exp]	8.7	0.8901
AT1G79820		SGB1	SUPPRESSOR OF G PROTEIN BETA1,...		Lus10035862 [exp]	9.5	0.8886
AT2G20100	bHLH		basic helix-loop-helix (bHLH) ...		Lus10023669 [exp]	10.8	0.8785
AT1G07200			Double Clp-N motif-containing ...		Lus10028281 [exp]	11.2	0.8840
AT1G71070			Core-2/I-branching beta-1,6-N-...		Lus10034829 [exp]	12.0	0.8793
AT1G29950	bHLH		basic helix-loop-helix (bHLH) ...		Lus10004926 [exp]	12.8	0.8742

Compare expression of checked genes

Lus10036593 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.