Lus10036597 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30700 73 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035815 129 / 4e-36 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10029436 47 / 3e-07 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10024222 44 / 4e-06 AT1G74630 719 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018223 38 / 0.0006 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G181800 79 / 3e-18 AT4G30700 1025 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G083900 38 / 0.0005 AT2G36730 552 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10036597 pacid=23174437 polypeptide=Lus10036597 locus=Lus10036597.g ID=Lus10036597.BGIv1.0 annot-version=v1.0
ATGGCGGCCGCCGGAGCCGTAACGACAACGGCAGGGACAGCGACAACATACCTTCCTCGTGCCCGCGGCCTACTCCTAAATCTCCTCTCAAGAGCCGCCA
ATCTCTCTCACCTCACTGAAATCCACGCGCAGCTCCTATACCACGGCTCCCAAAACGACATTCCTTTCGCCACAAAGCTCACTCAACGCCTATTCGATTT
CAACGCCGTTCACCACGCTCGTTCCCTCTTCTTCATCGTTTCGGGACCCGATCGTTTTTTGTATAACGTACTCGTCAAAGGCTTAGCTAGCAAAGATTCT
CCGAGATCGGCAATTCGGTATTTAACCATTTGA
AA sequence
>Lus10036597 pacid=23174437 polypeptide=Lus10036597 locus=Lus10036597.g ID=Lus10036597.BGIv1.0 annot-version=v1.0
MAAAGAVTTTAGTATTYLPRARGLLLNLLSRAANLSHLTEIHAQLLYHGSQNDIPFATKLTQRLFDFNAVHHARSLFFIVSGPDRFLYNVLVKGLASKDS
PRSAIRYLTI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30700 Pentatricopeptide repeat (PPR)... Lus10036597 0 1
AT2G37500 arginine biosynthesis protein ... Lus10023757 1.7 0.6523
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10021007 11.2 0.6366
AT4G30700 Pentatricopeptide repeat (PPR)... Lus10036596 11.8 0.6768
AT3G54700 PHT1;7 phosphate transporter 1;7 (.1) Lus10022934 22.6 0.6057
Lus10001546 24.2 0.6068
AT2G23945 Eukaryotic aspartyl protease f... Lus10002276 26.1 0.5934
AT1G45616 AtRLP6 receptor like protein 6 (.1) Lus10005050 27.6 0.5841
AT4G20270 BAM3 BARELY ANY MERISTEM 3, Leucine... Lus10043327 29.3 0.6122
AT1G58520 RXW8 lipases;hydrolases, acting on ... Lus10036752 30.2 0.5755
Lus10019796 35.7 0.6152

Lus10036597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.