Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57860 149 / 2e-48 Ubiquitin-like superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035816 [exp] 213 / 2e-73 AT5G57860 147 / 1e-47 Ubiquitin-like superfamily protein (.1.2.3.4) Lus10034563 [exp] 38 / 0.0005 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G181400 [exp] 186 / 9e-63 AT5G57860 151 / 2e-49 Ubiquitin-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10036598 pacid=23174356 polypeptide=Lus10036598 locus=Lus10036598.g ID=Lus10036598.BGIv1.0 annot-version=v1.0 ATGGCTATGTACATCCGGGTTAAAAGAAACAAAACAACTTACTTTATCCAATGTGATCCAACTGAGAAAACCCTTGAGATTAAGCAGAAACTGAATGCCA TAGTTGACCAACCGGTTAATGATCAGAGACTGATCCTTATGCCATCAGGGGAGGTGTTAGAGGATTCTAAATCACTGGCAGATCAGAAGGTTGAGAATGA TGCTGTAGTGGCTCTCACCTTCCGCAAAGAGGACAATCAGTTTGAGGAGGTCAACATTGTCCGCCCGGATGATTTTTATCCGTCCCGTGAAGCAGATGGT GGCAGCTGGTGA
AA sequence Show only first row Show all	>Lus10036598 pacid=23174356 polypeptide=Lus10036598 locus=Lus10036598.g ID=Lus10036598.BGIv1.0 annot-version=v1.0 MAMYIRVKRNKTTYFIQCDPTEKTLEIKQKLNAIVDQPVNDQRLILMPSGEVLEDSKSLADQKVENDAVVALTFRKEDNQFEEVNIVRPDDFYPSREADG GSW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G57860			Ubiquitin-like superfamily pro...		Lus10036598 [exp]	0	1
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	1.7	0.8526
AT1G76200			unknown protein		Lus10016001 [exp]	4.9	0.8439
AT4G17010			unknown protein		Lus10006582 [exp]	5.0	0.8314
AT4G21720			unknown protein		Lus10028771 [exp]	6.0	0.7819
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10032014 [exp]	9.5	0.7865
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10032532 [exp]	9.9	0.8242
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10004221 [exp]	9.9	0.8382
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10021335 [exp]	10.2	0.8057
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	11.6	0.7699
AT1G67620			Lojap-related protein (.1)		Lus10036979 [exp]	12.0	0.8227

Compare expression of checked genes

Lus10036598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.