Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39620 215 / 2e-67 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G09820 70 / 7e-14 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G18110 70 / 1e-13 EMB1270 embryo defective 1270, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G02420 67 / 5e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74900 67 / 7e-13 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G35130 63 / 1e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G41720 63 / 2e-11 EMB2654 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G51965 63 / 2e-11 ABO5 ABA Overly-Sensitive 5 (.1) AT1G63080 62 / 4e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39980 60 / 2e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035850 [exp] 410 / 1e-143 AT4G39620 579 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10042362 [exp] 71 / 5e-14 AT1G02420 613 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026306 [exp] 67 / 9e-13 AT1G02420 522 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025473 [exp] 66 / 3e-12 AT2G18940 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10041429 [exp] 64 / 8e-12 AT5G39980 976 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10006962 [exp] 64 / 1e-11 AT2G18940 976 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013894 [exp] 62 / 6e-11 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002107 [exp] 61 / 1e-10 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018318 [exp] 61 / 1e-10 AT2G35130 801 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G082400 [exp] 263 / 3e-86 AT4G39620 625 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G046100 [exp] 69 / 1e-13 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.012G123600 [exp] 69 / 2e-13 AT2G35130 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.019G049400 [exp] 67 / 6e-13 AT5G27270 1179 / 0.0 EMBRYO DEFECTIVE 976, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G079400 [exp] 67 / 1e-12 AT1G02420 649 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G149800 [exp] 67 / 1e-12 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.004G074500 [exp] 67 / 1e-12 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050180 [exp] 66 / 1e-12 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.015G070200 [exp] 66 / 2e-12 AT1G74900 590 / 0.0 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050500 [exp] 65 / 3e-12 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10036632 pacid=23174415 polypeptide=Lus10036632 locus=Lus10036632.g ID=Lus10036632.BGIv1.0 annot-version=v1.0 ATGGAACAAGTTTTCCAGAGCTTGCTGCAATCCAAGGAGAAGTCAACTCTTCCTACGTTTAATTCTATGATAATCAACTATGGCAAGGCTCGACAGAGAG ACAGAGCGCAGGATGTGTTCAACAAGATGAATGATTTGAAATATACTCCGAGTTTCATTACCTACGAGAGTCTTATCATGATGTATGGATTTTGTGATTG TGTCACTAATGCCAGAGGGGTATTTGACTCCATGGTTGAATCTGGGAAGGAGGTCAGAGTTTCGACTTTGAACGCCATGCTTGATGTTTACTGCATGAAT AAGCTGCACATTGAAGCACACTCCCTTGTCGAAAGTGCACGGGGCCTTGGGTTGTCCCCAGATTCATCGACGTATAAGCTTCTTTATAAGGCCTACACTA AAGCTAACAACAAAGAGCTTGTACAGAAATTGCTCAAGCGTATGGAGAAAGATGGTATCGTCATCCAGGATAGTAAATTCTTCCTAGATGCCTTGGGTGC TTCTCAACCTTCTAAACGAGAAGGTTCAGCGGCTTCTAGCAAGGATTCTAGGAGATCAGGTAATTCACAACAGAGTCTGAAGAAAACTGGCCAGAAGCTT ACAACCAGCCCGGTTAAGACGCATAGCTCTGTGAAGAAGATGAATGGAACTTGA
AA sequence Show only first row Show all	>Lus10036632 pacid=23174415 polypeptide=Lus10036632 locus=Lus10036632.g ID=Lus10036632.BGIv1.0 annot-version=v1.0 MEQVFQSLLQSKEKSTLPTFNSMIINYGKARQRDRAQDVFNKMNDLKYTPSFITYESLIMMYGFCDCVTNARGVFDSMVESGKEVRVSTLNAMLDVYCMN KLHIEAHSLVESARGLGLSPDSSTYKLLYKAYTKANNKELVQKLLKRMEKDGIVIQDSKFFLDALGASQPSKREGSAASSKDSRRSGNSQQSLKKTGQKL TTSPVKTHSSVKKMNGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10036632 [exp]	0	1
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10035850 [exp]	1.0	0.9565
AT2G05990		ENR1, MOD1	MOSAIC DEATH 1, ENOYL-ACP REDU...		Lus10012019 [exp]	1.4	0.9494
AT4G18130		PHYE	phytochrome E (.1)		Lus10004592 [exp]	3.9	0.9431
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10036633 [exp]	4.0	0.9448
AT5G23310		FSD3	Fe superoxide dismutase 3 (.1)		Lus10010174 [exp]	5.9	0.9427
AT4G21770			Pseudouridine synthase family ...		Lus10007657 [exp]	6.0	0.9428
AT1G35680		RPL21C	chloroplast ribosomal protein ...		Lus10014819 [exp]	6.9	0.9493
AT1G15390		PDF1A, ATDEF1	peptide deformylase 1A (.1)		Lus10011493 [exp]	9.8	0.9135
AT3G46610			Pentatricopeptide repeat (PPR-...		Lus10032109 [exp]	9.9	0.9337
AT3G25660			Amidase family protein (.1)		Lus10007361 [exp]	10.1	0.9294

Compare expression of checked genes

Lus10036632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.