Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39620 218 / 9e-69 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G41720 69 / 6e-14 EMB2654 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G06430 64 / 3e-12 AtPPR2, EMB2750 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48730 59 / 2e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74850 59 / 2e-10 PDE343, PTAC2 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1) AT3G22670 57 / 1e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53170 55 / 4e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G06710 51 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G02860 50 / 2e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G18900 49 / 7e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035850 [exp] 361 / 9e-125 AT4G39620 579 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10042068 [exp] 65 / 3e-12 AT2G41720 1057 / 0.0 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10024893 [exp] 61 / 5e-11 AT3G53170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028683 [exp] 61 / 6e-11 AT3G06430 640 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016476 [exp] 60 / 8e-11 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000862 [exp] 60 / 1e-10 AT3G06430 644 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036651 [exp] 59 / 2e-10 AT1G74850 502 / 4e-170 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1) Lus10040756 [exp] 58 / 2e-10 AT3G46870 349 / 2e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033127 [exp] 59 / 4e-10 AT1G74850 1179 / 0.0 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G082400 [exp] 250 / 8e-82 AT4G39620 625 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.007G084750 [exp] 125 / 2e-37 AT4G39620 123 / 2e-34 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.006G049900 [exp] 63 / 8e-12 AT2G41720 1169 / 0.0 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.009G038200 [exp] 58 / 3e-10 AT3G46870 326 / 2e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G058300 [exp] 54 / 8e-09 AT3G53170 618 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G069100 [exp] 54 / 1e-08 AT1G74850 1268 / 0.0 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1) Potri.002G243600 [exp] 52 / 7e-08 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G015900 [exp] 51 / 1e-07 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.008G142900 [exp] 51 / 1e-07 AT5G13770 544 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G182900 [exp] 51 / 1e-07 AT4G01570 1045 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10036633 pacid=23174512 polypeptide=Lus10036633 locus=Lus10036633.g ID=Lus10036633.BGIv1.0 annot-version=v1.0 ATGGCGCTCTGTCATATCTCACCCTTCCATACCCTCCATATTGGTTCAATTGACAACCTCAAACTTCCATTGCAGCGACGACAACAGCTCCCCTTCTGCG TCGCCTGCGTCTCGACGGCGAAATCCAAACCGAAGAGGAAATTTTCCCCGGACATCGAGAAAGCTGAATCCGAAGAGTTAGTTCGCAGCATTGTGAGGAG CTTTACGGAGAAAGAGTCCCTGTCAAAGACACTGAACAAATACGTCAGAATAGTCCGTACCCAGCACTGCTTTATGCTGTTCGAAGAGCTTGGAAGGAAG GGCAAGTGGCTTCAATGTCTCGAGGTGTTCAGATGGATGCAGAAACAGCGATGGTACATTGCCGATAATGGCGTATACTCCAAGCTGATATCCGTAATGG GGAAGCATGGACAAATCCGGATGGCAATGTGGCTTTTCTCAGAGATGCGTAACAGTGGATGTCGTCCGGATACTTCCGTCTACAATTCTCTGATATCAGC CCACTTGCATTCCAGGGACAAATCCAAAGCTCTAACCAAGGCACATGGTTACTTCGACAATTGA
AA sequence Show only first row Show all	>Lus10036633 pacid=23174512 polypeptide=Lus10036633 locus=Lus10036633.g ID=Lus10036633.BGIv1.0 annot-version=v1.0 MALCHISPFHTLHIGSIDNLKLPLQRRQQLPFCVACVSTAKSKPKRKFSPDIEKAESEELVRSIVRSFTEKESLSKTLNKYVRIVRTQHCFMLFEELGRK GKWLQCLEVFRWMQKQRWYIADNGVYSKLISVMGKHGQIRMAMWLFSEMRNSGCRPDTSVYNSLISAHLHSRDKSKALTKAHGYFDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10036633 [exp]	0	1
AT4G23940			FtsH extracellular protease fa...		Lus10023066 [exp]	1.4	0.9642
AT2G26900		BASS2	bile acid:sodium symporter fam...		Lus10006672 [exp]	2.4	0.9503
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10036632 [exp]	4.0	0.9448
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10041655 [exp]	4.6	0.9397
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Lus10033755 [exp]	5.1	0.9331
AT3G48500		PDE312, PTAC10	PLASTID TRANSCRIPTIONALLY ACTI...		Lus10005031 [exp]	6.0	0.9488
AT2G05990		ENR1, MOD1	MOSAIC DEATH 1, ENOYL-ACP REDU...		Lus10016274 [exp]	8.1	0.9401
AT3G04260		PDE324, PTAC3	PIGMENT DEFECTIVE 324, plastid...		Lus10003578 [exp]	8.9	0.9438
AT3G14620		CYP72A8	"cytochrome P450, family 72, s...		Lus10026681 [exp]	9.8	0.9185
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Lus10035850 [exp]	10.5	0.9369

Compare expression of checked genes

Lus10036633 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.