Lus10036643 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48090 44 / 7e-06 ATEDS1, EDS1 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2)
AT3G48080 41 / 7e-05 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042937 197 / 2e-61 AT3G48090 416 / 2e-138 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G074700 105 / 2e-27 AT3G48080 426 / 7e-142 alpha/beta-Hydrolases superfamily protein (.1)
Potri.015G069600 89 / 7e-22 AT3G48090 424 / 2e-141 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.012G074600 48 / 2e-07 AT3G48080 156 / 1e-42 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10036643 pacid=23174485 polypeptide=Lus10036643 locus=Lus10036643.g ID=Lus10036643.BGIv1.0 annot-version=v1.0
ATGGGGAGCGTGAATCTGGTGGATAACCTGAACGTGAAAGCGGAGCTGGTGAGGAAAGCTTGCTCCCTCGCCGTCAAATCCCACAAGTCGCAGCAGCTTT
TCCAATCTGAAAAGTCCCGGGGATCGCCGGAAGTTGTTTTCAGCTTCCCTGGAAGTTGGAACCTCGGGGATTGGATCAGTAAGCCGCCGTTCGGTGAAGT
TGAGGTCGATCTTCAGCTATTCCCTTCCCTCTTGTATATCGGTCTCAAGGAACCCGGCTCCGTCAATGAAGCTTTCTTGCGGAGGGTTCCCGCCGTTTTG
GGCCCGGGGTGGCTGAACTTATTTGCGGACAACAACCCTAAATTAAGCTGA
AA sequence
>Lus10036643 pacid=23174485 polypeptide=Lus10036643 locus=Lus10036643.g ID=Lus10036643.BGIv1.0 annot-version=v1.0
MGSVNLVDNLNVKAELVRKACSLAVKSHKSQQLFQSEKSRGSPEVVFSFPGSWNLGDWISKPPFGEVEVDLQLFPSLLYIGLKEPGSVNEAFLRRVPAVL
GPGWLNLFADNNPKLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10036643 0 1
AT1G49740 PLC-like phosphodiesterases su... Lus10012665 12.1 0.6593
AT1G08720 EDR1, ATEDR1 ENHANCED DISEASE RESISTANCE 1,... Lus10004124 18.2 0.6388
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10039024 24.5 0.6239
AT1G43700 bZIP SUE3, AtbZIP51,... sulphate utilization efficienc... Lus10042802 24.7 0.6432
AT1G30000 MNS3 alpha-mannosidase 3 (.1) Lus10042830 30.5 0.6454
AT4G05150 Octicosapeptide/Phox/Bem1p fam... Lus10018412 31.1 0.6326
AT3G04240 SEC secret agent, Tetratricopeptid... Lus10003113 31.9 0.6091
AT5G66880 SNRK2-3, SNRK2.... SUCROSE NONFERMENTING 1 \(SNF1... Lus10019641 32.7 0.6283
AT5G07920 ATDGK1, DGK1 DIACYLGLYCEROL KINASE 1, diacy... Lus10034701 36.4 0.6054
AT3G04240 SEC secret agent, Tetratricopeptid... Lus10004779 36.9 0.6268

Lus10036643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.