Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74770 79 / 2e-19 zinc ion binding (.1) AT3G18290 77 / 1e-18 BTS, EMB2454 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) AT1G18910 76 / 2e-18 zinc ion binding;zinc ion binding (.1) AT5G25560 48 / 2e-08 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1.2.3.4) AT3G62970 46 / 1e-07 zinc finger (C3HC4-type RING finger) family protein (.1) AT5G22920 43 / 1e-06 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033112 [exp] 90 / 6e-25 AT1G18910 75 / 6e-16 zinc ion binding;zinc ion binding (.1) Lus10042188 [exp] 85 / 8e-23 AT1G74770 253 / 2e-78 zinc ion binding (.1) Lus10008628 [exp] 85 / 3e-21 AT1G74770 1024 / 0.0 zinc ion binding (.1) Lus10005111 [exp] 76 / 6e-18 AT3G18290 1592 / 0.0 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) Lus10034346 [exp] 75 / 7e-18 AT3G18290 1467 / 0.0 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) Lus10023914 [exp] 40 / 1e-05 AT5G22920 225 / 8e-72 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G066600 [exp] 87 / 3e-22 AT1G74770 1199 / 0.0 zinc ion binding (.1) Potri.010G122200 [exp] 74 / 2e-17 AT3G18290 1578 / 0.0 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) Potri.008G123300 [exp] 74 / 2e-17 AT3G18290 1604 / 0.0 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) Potri.012G055100 [exp] 73 / 4e-17 AT3G18290 1641 / 0.0 embryo defective 2454, BRUTUS, zinc finger protein-related (.1) Potri.006G245400 [exp] 42 / 2e-06 AT5G25560 475 / 7e-171 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1.2.3.4) Potri.014G134400 [exp] 40 / 2e-05 AT3G62970 393 / 3e-139 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.009G005700 [exp] 39 / 2e-05 AT5G22920 437 / 8e-156 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1) Potri.006G121801 [exp] 38 / 8e-05 AT5G22920 398 / 6e-141 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1) Potri.008G205400 [exp] 35 / 0.0007 AT5G18650 466 / 2e-168 CHY-type/CTCHY-type/RING-type Zinc finger protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036664 pacid=23174655 polypeptide=Lus10036664 locus=Lus10036664.g ID=Lus10036664.BGIv1.0 annot-version=v1.0 ATGCTGGATGTCCTTTTAGCGGAAGAAAAAGCTCCAGAAGAATATGCAAGACAAACTCAGGGATTCCAGGCCATTCTTTGCAATGATTGTGAGAAGAAAG GTGATGCACGCTTCCACTGGCTCTATTACAAGTGCCCAAATTGTGGATCTTACAACACCAAGCTTCTATAA
AA sequence Show only first row Show all	>Lus10036664 pacid=23174655 polypeptide=Lus10036664 locus=Lus10036664.g ID=Lus10036664.BGIv1.0 annot-version=v1.0 MLDVLLAEEKAPEEYARQTQGFQAILCNDCEKKGDARFHWLYYKCPNCGSYNTKLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18290		BTS, EMB2454	embryo defective 2454, BRUTUS,...		Lus10036664 [exp]	0	1
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10007138 [exp]	3.5	0.9439
AT3G60140		BGLU30, SRG2, D...	SENESCENCE-RELATED GENE 2, DAR...		Lus10030520 [exp]	4.9	0.8519
AT1G11340			S-locus lectin protein kinase ...		Lus10014723 [exp]	5.6	0.6935
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	6.8	0.8672
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	8.3	0.8672
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	9.6	0.8672
					Lus10033149 [exp]	10.7	0.8672
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10003281 [exp]	11.7	0.8672
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	12.7	0.8672
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	13.6	0.8672

Compare expression of checked genes

Lus10036664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.