Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27100 49 / 4e-08 Actin cross-linking protein (.1) AT3G28630 47 / 9e-08 Protein of unknown function (DUF569) (.1), Protein of unknown function (DUF569) (.2) AT1G59710 37 / 0.0004 Protein of unknown function (DUF569) (.1) AT1G69900 36 / 0.001 Actin cross-linking protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037231 [exp] 99 / 1e-26 AT1G27100 192 / 2e-57 Actin cross-linking protein (.1) Lus10036693 [exp] 56 / 4e-11 AT1G27100 180 / 2e-54 Actin cross-linking protein (.1) Lus10015346 [exp] 47 / 2e-07 AT3G28630 317 / 3e-107 Protein of unknown function (DUF569) (.1), Protein of unknown function (DUF569) (.2) Lus10001124 [exp] 46 / 5e-07 AT3G28630 313 / 1e-105 Protein of unknown function (DUF569) (.1), Protein of unknown function (DUF569) (.2) Lus10036694 [exp] 41 / 2e-05 AT1G59710 343 / 5e-119 Protein of unknown function (DUF569) (.1) Lus10037230 [exp] 40 / 4e-05 AT1G27100 181 / 3e-54 Actin cross-linking protein (.1) Lus10013281 [exp] 38 / 0.0002 AT1G59710 240 / 2e-79 Protein of unknown function (DUF569) (.1) Lus10030804 [exp] 38 / 0.0003 AT1G59710 357 / 2e-124 Protein of unknown function (DUF569) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G035100 [exp] 61 / 3e-12 AT1G27100 541 / 0.0 Actin cross-linking protein (.1) Potri.008G193900 [exp] 58 / 2e-11 AT1G27100 494 / 2e-171 Actin cross-linking protein (.1) Potri.004G130200 [exp] 52 / 2e-09 AT1G27100 421 / 2e-143 Actin cross-linking protein (.1) Potri.017G075900 [exp] 49 / 4e-08 AT1G27100 431 / 1e-147 Actin cross-linking protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [flax] [poplar] Trefoil PF04601 [flax] [poplar] DUF569 Domain of unknown function (DUF569)
Representative CDS sequence Show only first row Show all	>Lus10036692 pacid=23171145 polypeptide=Lus10036692 locus=Lus10036692.g ID=Lus10036692.BGIv1.0 annot-version=v1.0 ATGGGCAGCAAGGTTGTCCAAACGGTGCCGGATGGTCGGAATTGTTCCGATGAGGAGAATTCCAGGATGGAGTGGCGGCCGGTGAGGGATGGGTTTCAGG TGAGGCTGAAAAACAGCTGGTGCGGGAAGTACCTAAGGGCTAACGGCGGGGCGCGCGCCGAGGGGGTGTGTGAGTACGCCGCCGCGCACCGCGACCGCGT GGAGGAACTCGGTCACCAACGACAAGCGCAATTTGAGCCCGACGCGTGA
AA sequence Show only first row Show all	>Lus10036692 pacid=23171145 polypeptide=Lus10036692 locus=Lus10036692.g ID=Lus10036692.BGIv1.0 annot-version=v1.0 MGSKVVQTVPDGRNCSDEENSRMEWRPVRDGFQVRLKNSWCGKYLRANGGARAEGVCEYAAAHRDRVEELGHQRQAQFEPDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27100			Actin cross-linking protein (....		Lus10036692 [exp]	0	1

Compare expression of checked genes

Lus10036692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.