Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39950 82 / 1e-20 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 81 / 3e-20 ATH7 thioredoxin H-type 7 (.1) AT1G69880 72 / 2e-16 ATH8 thioredoxin H-type 8 (.1) AT5G42980 65 / 5e-14 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 64 / 1e-13 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G51030 63 / 2e-13 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G45145 59 / 1e-11 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G17880 55 / 3e-09 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G43560 44 / 5e-06 ATY2 thioredoxin Y2 (.1) AT3G56420 44 / 6e-06 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037228 [exp] 213 / 4e-72 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 186 / 3e-61 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10037227 [exp] 186 / 5e-61 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10037225 [exp] 100 / 2e-27 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10036698 [exp] 96 / 1e-25 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1) Lus10005258 [exp] 80 / 9e-20 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10030666 [exp] 79 / 2e-19 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10000802 [exp] 72 / 1e-16 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 71 / 2e-16 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G194100 [exp] 108 / 1e-30 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 89 / 4e-23 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G232700 [exp] 60 / 3e-12 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 59 / 7e-12 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 54 / 4e-10 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 56 / 1e-09 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.012G045000 [exp] 52 / 3e-08 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.002G066800 [exp] 44 / 9e-06 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.005G193400 [exp] 42 / 2e-05 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.006G110100 [exp] 42 / 3e-05 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10036695 pacid=23171273 polypeptide=Lus10036695 locus=Lus10036695.g ID=Lus10036695.BGIv1.0 annot-version=v1.0 ATGAGTTACGGTTTCCCTAATTTCCAGAGAAGAAGGTCACCAATGGTGGTGAGCTCCATGGACTTCAACTTCCACAACCATGGATCATACTTGTACAAGA AGCCAGTTACCTCATCCGGGTTCGTTGAGGTGCACTCTGCAACTAAGCCATCTTTGGTGGTGGAGGTTAACTCTGCAAGCCAATGGAAGTCCTACTTTGA TACTTCCAGGGATAACAACAAGTTGTTGGTCATACAGTTTACTGGGACGTGGTGCGGACCTTGTCGACATATGGAGCCGGTCATGGCAGGGTTTGCTGTT AAATACGTGGATGTCGTGTTTATCAAGATCGACGTTGACAAGTTACCGTCTGTGGCTCGTCAGTTCGATATCCAGATAATGCCTGGATTTGCACTGATCA AGAAAGGGAAAGAGGTTGATAAGGTGGGAGGAGTTAAGAAGAATGAACTTCAAACCAAGATCGAAAAGCACCGGCTATAA
AA sequence Show only first row Show all	>Lus10036695 pacid=23171273 polypeptide=Lus10036695 locus=Lus10036695.g ID=Lus10036695.BGIv1.0 annot-version=v1.0 MSYGFPNFQRRRSPMVVSSMDFNFHNHGSYLYKKPVTSSGFVEVHSATKPSLVVEVNSASQWKSYFDTSRDNNKLLVIQFTGTWCGPCRHMEPVMAGFAV KYVDVVFIKIDVDKLPSVARQFDIQIMPGFALIKKGKEVDKVGGVKKNELQTKIEKHRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Lus10036695 [exp]	0	1
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10037228 [exp]	3.2	0.8626
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10014821 [exp]	5.1	0.8941
AT2G22790			unknown protein		Lus10011575 [exp]	7.4	0.8591
AT1G58340		BCD1, ZRZ, ZF14	ZRIZI, BUSH-AND-CHLOROTIC-DWAR...		Lus10007231 [exp]	7.7	0.8881
AT5G19040		ATIPT5	Arabidopsis thaliana ISOPENTEN...		Lus10034025 [exp]	9.7	0.8871
AT1G52700			alpha/beta-Hydrolases superfam...		Lus10026054 [exp]	9.8	0.8325
AT5G63710			Leucine-rich repeat protein ki...		Lus10025703 [exp]	11.0	0.8886
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10003944 [exp]	12.1	0.8677
AT5G27690			Heavy metal transport/detoxifi...		Lus10033469 [exp]	12.6	0.8871
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Lus10036539 [exp]	13.0	0.8656

Compare expression of checked genes

Lus10036695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.