Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59730 107 / 2e-30 ATH7 thioredoxin H-type 7 (.1) AT5G39950 105 / 2e-29 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G69880 104 / 6e-29 ATH8 thioredoxin H-type 8 (.1) AT5G42980 90 / 7e-24 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G45145 85 / 9e-22 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT1G19730 84 / 2e-21 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G51030 80 / 7e-20 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT3G17880 76 / 1e-16 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G11530 66 / 3e-14 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT3G56420 66 / 6e-14 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037227 [exp] 224 / 3e-76 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10036695 [exp] 217 / 3e-73 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037228 [exp] 204 / 3e-68 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10037225 [exp] 124 / 4e-37 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10036698 [exp] 118 / 1e-34 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1) Lus10030666 [exp] 105 / 1e-29 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10005258 [exp] 104 / 3e-29 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10024293 [exp] 95 / 2e-25 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 93 / 7e-25 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G194100 [exp] 135 / 4e-41 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 115 / 2e-33 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G232700 [exp] 84 / 3e-21 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 83 / 4e-21 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 77 / 1e-18 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 77 / 5e-17 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.012G045000 [exp] 75 / 2e-16 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.004G031700 [exp] 66 / 2e-14 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 64 / 2e-13 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.001G416500 [exp] 63 / 4e-13 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10036696 pacid=23171213 polypeptide=Lus10036696 locus=Lus10036696.g ID=Lus10036696.BGIv1.0 annot-version=v1.0 ATGAGTTGCGGATTCCCTCATTTCCAGAGAAGATCAAGATCGCCAGTGATCGTAAGCTCCACGGACTTCAACTTCCCCAACAAGAAGTGGGTTCCCTCGT CGGGGTTCGTTGAGGTCCAGTCATCCACAACTCCGTGGAACGTCAAACCGGCCTCGCCATCTTTGGTGGTGGAGGTTAACTCTACAAGCCAATGGAAGAC CTACTTTGATGCTGCCAAGGATAATAACAAGTTGTTGGTTGTACAATTTACTGCGACGTGGTGTGGACCGTGTCGACATATGGAGCCGGTCATGGCAGAG TTTGCTGCTAAGTACACGGATGTTGTGTTCATCAAGATCGACGTTGATAATTTACCGGGGGTGGCTGGTCAGTTTGATGTCCAGATAATGCCTGGATTTG CACTGATCAAGAAGGGGAAAGAGGTTGATAAGGTTGGAGGAGTGAAGAAGTATGAACTTCAGACTAAGATTGAAAAGCACAGGCTTTGA
AA sequence Show only first row Show all	>Lus10036696 pacid=23171213 polypeptide=Lus10036696 locus=Lus10036696.g ID=Lus10036696.BGIv1.0 annot-version=v1.0 MSCGFPHFQRRSRSPVIVSSTDFNFPNKKWVPSSGFVEVQSSTTPWNVKPASPSLVVEVNSTSQWKTYFDAAKDNNKLLVVQFTATWCGPCRHMEPVMAE FAAKYTDVVFIKIDVDNLPGVAGQFDVQIMPGFALIKKGKEVDKVGGVKKYELQTKIEKHRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10036696 [exp]	0	1
AT1G75820		ATCLV1, FLO5, F...	FLOWER DEVELOPMENT 5, FASCIATA...		Lus10040592 [exp]	5.3	0.7637
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10017463 [exp]	18.2	0.6864
AT1G78160		APUM7	pumilio 7 (.1)		Lus10036469 [exp]	20.6	0.6754
AT5G35200			ENTH/ANTH/VHS superfamily prot...		Lus10003642 [exp]	21.9	0.7840
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	25.3	0.7791
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Lus10007404 [exp]	30.2	0.7336
					Lus10021684 [exp]	35.2	0.6773
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10033172 [exp]	36.3	0.7331
AT5G62040		BFT	brother of FT and TFL1, PEBP (...		Lus10005753 [exp]	37.6	0.6927
AT5G65030			unknown protein		Lus10024055 [exp]	38.4	0.7014

Compare expression of checked genes

Lus10036696 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.