Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69880 93 / 5e-25 ATH8 thioredoxin H-type 8 (.1) AT1G59730 91 / 2e-24 ATH7 thioredoxin H-type 7 (.1) AT5G39950 90 / 7e-24 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT5G42980 82 / 5e-21 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G45145 81 / 1e-20 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G51030 80 / 5e-20 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G19730 76 / 2e-18 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G56420 65 / 5e-14 Thioredoxin superfamily protein (.1) AT1G76760 57 / 7e-11 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G31020 56 / 3e-10 ATO2 thioredoxin O2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037225 [exp] 201 / 1e-67 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10037228 [exp] 123 / 9e-37 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10036695 [exp] 117 / 5e-34 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037227 [exp] 114 / 3e-33 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 112 / 2e-32 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10030666 [exp] 95 / 9e-26 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10005258 [exp] 94 / 3e-25 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10041799 [exp] 86 / 2e-22 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 84 / 2e-21 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G194100 [exp] 96 / 5e-26 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 93 / 7e-25 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G232700 [exp] 82 / 3e-21 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 79 / 8e-20 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 78 / 2e-19 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.004G031700 [exp] 64 / 5e-14 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.005G193400 [exp] 60 / 5e-12 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.002G066800 [exp] 59 / 9e-12 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.006G110100 [exp] 59 / 9e-12 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.012G045000 [exp] 59 / 4e-11 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10036698 pacid=23171097 polypeptide=Lus10036698 locus=Lus10036698.g ID=Lus10036698.BGIv1.0 annot-version=v1.0 ATGTCTTCAATGATGGGAATCAGCACTACTAGCCTTACTGACCTCCATTCACAACAAAAGCAGCAGCACCAGCGGCTTGTGGAAGTTCGCTGTTTATCAC AGTGGAAATCCTGCCTCGAATCCTCCAGACGGAGCAACAAACTCTTGGTGGTGGATTTCACAGCTGCATGGTGCAGACCATGTCGATTCATGGAGCCGGC GTTGGGGGAGTTTGCGGCCAAGTATCCTGACATTGAGTTCATCAAGATCGATGTCGATAGGCTCCCGTCAGTGGCTAAAGAATTTGCGGTGCAGATAATG CCAATGGTGGCTGTGGTGAAAGGAGGGAAAGAAGTAGTGGATAAAGTTGAAGGAGTTAAGAAGACTGAGCTTCAGGGTAAGATTGAGAAACACAGGGCAC AATTCAGTTGTTGTCACTGA
AA sequence Show only first row Show all	>Lus10036698 pacid=23171097 polypeptide=Lus10036698 locus=Lus10036698.g ID=Lus10036698.BGIv1.0 annot-version=v1.0 MSSMMGISTTSLTDLHSQQKQQHQRLVEVRCLSQWKSCLESSRRSNKLLVVDFTAAWCRPCRFMEPALGEFAAKYPDIEFIKIDVDRLPSVAKEFAVQIM PMVAVVKGGKEVVDKVEGVKKTELQGKIEKHRAQFSCCH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69880		ATH8	thioredoxin H-type 8 (.1)		Lus10036698 [exp]	0	1
AT5G64810	WRKY	ATWRKY51, WRKY5...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10035841 [exp]	1.4	0.9262
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Lus10005813 [exp]	6.3	0.8803
AT4G08500		ARAKIN, ATMEKK1...	MAPK/ERK kinase kinase 1 (.1)		Lus10042750 [exp]	7.7	0.8940
AT2G23970			Class I glutamine amidotransfe...		Lus10019964 [exp]	11.1	0.9069
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10027279 [exp]	11.2	0.8812
AT2G28500	AS2	LBD11	LOB domain-containing protein ...		Lus10036130 [exp]	13.0	0.8902
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015354 [exp]	13.1	0.8806
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Lus10039702 [exp]	14.0	0.8990
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10004846 [exp]	14.1	0.8785
AT4G04900		RIC10	ROP-interactive CRIB motif-con...		Lus10006763 [exp]	15.0	0.8929

Compare expression of checked genes

Lus10036698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.