Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20050 76 / 3e-18 ATTCP-1 T-complex protein 1 alpha subunit (.1) AT1G24510 37 / 0.0001 TCP-1/cpn60 chaperonin family protein (.1.2) AT1G67760 37 / 0.0002 TCP-1/cpn60 chaperonin family protein (.1) AT3G18190 35 / 0.0007 TCP-1/cpn60 chaperonin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037214 [exp] 92 / 1e-23 AT3G20050 999 / 0.0 T-complex protein 1 alpha subunit (.1) Lus10032467 [exp] 92 / 1e-23 AT3G20050 996 / 0.0 T-complex protein 1 alpha subunit (.1) Lus10042966 [exp] 91 / 3e-23 AT3G20050 991 / 0.0 T-complex protein 1 alpha subunit (.1) Lus10011401 [exp] 37 / 0.0001 AT1G24510 1012 / 0.0 TCP-1/cpn60 chaperonin family protein (.1.2) Lus10006457 [exp] 37 / 0.0001 AT1G24510 1009 / 0.0 TCP-1/cpn60 chaperonin family protein (.1.2) Lus10040514 [exp] 36 / 0.0006 AT5G26360 996 / 0.0 TCP-1/cpn60 chaperonin family protein (.1) Lus10034682 [exp] 35 / 0.001 AT5G26360 1016 / 0.0 TCP-1/cpn60 chaperonin family protein (.1) Lus10021150 [exp] 35 / 0.001 AT5G26360 1046 / 0.0 TCP-1/cpn60 chaperonin family protein (.1) Lus10017853 [exp] 35 / 0.001 AT5G26360 1041 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G058500 [exp] 81 / 5e-20 AT3G20050 1006 / 0.0 T-complex protein 1 alpha subunit (.1) Potri.002G142700 [exp] 77 / 8e-19 AT3G20050 994 / 0.0 T-complex protein 1 alpha subunit (.1) Potri.012G051300 [exp] 36 / 0.0005 AT3G18190 942 / 0.0 TCP-1/cpn60 chaperonin family protein (.1) Potri.015G042600 [exp] 35 / 0.001 AT3G18190 922 / 0.0 TCP-1/cpn60 chaperonin family protein (.1) Potri.004G195300 [exp] 35 / 0.001 AT3G11830 985 / 0.0 TCP-1/cpn60 chaperonin family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036713 pacid=23171319 polypeptide=Lus10036713 locus=Lus10036713.g ID=Lus10036713.BGIv1.0 annot-version=v1.0 ATGGCGCTCTCATCCCAAACTCTGGTTATTCAAGGTGAACGCCAGTCTGGCCAGGACGTCCGCGCTCAAAATGTGATGGCTTGCCAAGCAGTTGCGAACA TTGTTAAATCCTCACTAGGTCCAGTTGGGCTTGACAAGTATTCCTCTGCCATCCATTATCACTGA
AA sequence Show only first row Show all	>Lus10036713 pacid=23171319 polypeptide=Lus10036713 locus=Lus10036713.g ID=Lus10036713.BGIv1.0 annot-version=v1.0 MALSSQTLVIQGERQSGQDVRAQNVMACQAVANIVKSSLGPVGLDKYSSAIHYH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Lus10036713 [exp]	0	1
AT3G03250		AtUGP1, UGP1, U...	UDP-GLUCOSE PYROPHOSPHORYLASE ...		Lus10031368 [exp]	1.0	0.8229
AT4G10620			P-loop containing nucleoside t...		Lus10035986 [exp]	3.2	0.7975
AT3G12340			FKBP-like peptidyl-prolyl cis-...		Lus10011649 [exp]	4.0	0.7199
AT4G14170			Pentatricopeptide repeat (PPR)...		Lus10026778 [exp]	4.9	0.7802
AT5G08680			ATP synthase alpha/beta family...		Lus10024114 [exp]	6.3	0.7499
AT5G11630			unknown protein		Lus10011623 [exp]	7.2	0.6948
					Lus10019215 [exp]	10.2	0.7896
AT3G16840			P-loop containing nucleoside t...		Lus10023706 [exp]	16.1	0.7836
AT1G09190			Tetratricopeptide repeat (TPR)...		Lus10029853 [exp]	17.9	0.7607
AT5G62440			Protein of unknown function (D...		Lus10023594 [exp]	21.0	0.7632

Compare expression of checked genes

Lus10036713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.