Lus10036715 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69840 500 / 0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT5G62740 475 / 2e-171 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT3G01290 424 / 4e-151 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G51570 323 / 4e-111 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 50 / 7e-07 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 45 / 3e-05 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037213 546 / 0 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10033099 484 / 8e-175 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 475 / 2e-171 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 460 / 3e-165 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 456 / 7e-164 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10038907 302 / 5e-103 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 302 / 6e-103 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10032909 49 / 2e-06 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G078000 484 / 5e-175 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078100 472 / 4e-170 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 465 / 2e-167 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 317 / 7e-109 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 308 / 1e-105 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 283 / 2e-96 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 50 / 1e-06 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 49 / 2e-06 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 48 / 4e-06 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Lus10036715 pacid=23171219 polypeptide=Lus10036715 locus=Lus10036715.g ID=Lus10036715.BGIv1.0 annot-version=v1.0
ATGGGTCAAGCTCTGGGTTGCGTCCAAGTGGATCAATCAAAAGTAGCTATCAAGGAAACTTTCGGGAAGTTCGACGAAGTGCTTCAGCCTGGCTGCCATT
GTCTCCCGTGGTGCTTGGGAAGCAGTGTCGCTGGCCATCTCTCTTTGCGAGTTCAACAGCTTGATGTCAGCTGCGAGACCAAGACAAAGGATAATGTGTT
TGTAACCGTTGTGGCATCTGTTCAATATCGAGCTCTCGCCGAGAAAGCATCCGATGCTTTCTACAAGCTGAGTAACACTAGAGGCCAGATCCAGTCATAT
GTGTTTGATGTCATCAGAGCAAGTCTCCCCAAGCTGAACCTGGATGCTGCATTTGAACAGAAGAATGACATAGCCAAAGCAGTAGAGCAGGAACTCGAAA
AGGCCATGTCGCATTATGGCTACGAGATAGTCCAGACCCTGATTGTTGATATCGAACCTGATGTACACGTCAAGAGGGCCATGAACGAGATCAATGCAGC
TTCCAGAATGAGGGAAGCAGCAAACGAGAGGGCCGAGGCGGAGAAGATACTCCAGATAAAACGAGCTGAAGCCGAAGCAGAATCCAAGTACCTAGCTGGT
GTTGGCATTGCGAGGCAGCGTCAGGCCATCGTGGATGGTCTAAGAGACAGCGTGCTGGCATTCTCCTCGAATGTACCGGGGACTAGTTCCAAGGATGTGA
TGGACATGGTCCTTGTCACCCAGTATTTCGACACGATGAAGGAGATTGGTGCGTCTTCCAAGAGCAGCTCCGTGTTCATTCCGCATGGCCCTGGTGCTGT
GAAGGACATTGCTTCTCAGATTAGGGAAGGTCTTCTTCAGGCCAATTCAACAGAGTAA
AA sequence
>Lus10036715 pacid=23171219 polypeptide=Lus10036715 locus=Lus10036715.g ID=Lus10036715.BGIv1.0 annot-version=v1.0
MGQALGCVQVDQSKVAIKETFGKFDEVLQPGCHCLPWCLGSSVAGHLSLRVQQLDVSCETKTKDNVFVTVVASVQYRALAEKASDAFYKLSNTRGQIQSY
VFDVIRASLPKLNLDAAFEQKNDIAKAVEQELEKAMSHYGYEIVQTLIVDIEPDVHVKRAMNEINAASRMREAANERAEAEKILQIKRAEAEAESKYLAG
VGIARQRQAIVDGLRDSVLAFSSNVPGTSSKDVMDMVLVTQYFDTMKEIGASSKSSSVFIPHGPGAVKDIASQIREGLLQANSTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69840 SPFH/Band 7/PHB domain-contain... Lus10036715 0 1
AT2G22905 Expressed protein (.1) Lus10012094 1.4 0.9309
AT2G33150 PED1, KAT2, PKT... PEROXISOME DEFECTIVE 1, 3-KETO... Lus10022812 3.9 0.9120
AT1G14860 ATNUDT18 nudix hydrolase homolog 18 (.1... Lus10003713 4.0 0.8739
AT5G61210 SNP33, ATSNAP33... soluble N-ethylmaleimide-sensi... Lus10015738 4.2 0.9138
AT1G66930 Protein kinase superfamily pro... Lus10008362 4.2 0.8844
AT2G46330 ATAGP16, AGP16 arabinogalactan protein 16 (.1... Lus10023629 6.6 0.9027
AT1G60670 Protein of unknown function (D... Lus10013072 8.2 0.8634
AT3G45640 ATMAPK3, ATMPK3 mitogen-activated protein kina... Lus10018127 9.5 0.8781
Lus10025204 9.7 0.8932
AT2G17890 CPK16 calcium-dependent protein kina... Lus10041914 10.2 0.8929

Lus10036715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.