Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02760 310 / 1e-110 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 308 / 2e-109 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 281 / 4e-99 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT4G27960 146 / 1e-45 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 145 / 3e-45 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 145 / 4e-45 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 142 / 3e-44 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 141 / 8e-44 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 140 / 2e-43 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 140 / 3e-43 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037203 [exp] 316 / 7e-113 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 311 / 8e-111 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 310 / 2e-110 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10014942 [exp] 145 / 2e-45 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 145 / 2e-45 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 145 / 3e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 145 / 3e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 145 / 4e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 145 / 4e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G064400 [exp] 312 / 2e-111 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 310 / 1e-110 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 310 / 2e-110 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 145 / 3e-45 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G094900 [exp] 145 / 4e-45 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 144 / 4e-45 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.015G023300 [exp] 144 / 5e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 144 / 5e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.016G138900 [exp] 144 / 5e-45 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G168200 [exp] 143 / 2e-44 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10036727 pacid=23171297 polypeptide=Lus10036727 locus=Lus10036727.g ID=Lus10036727.BGIv1.0 annot-version=v1.0 ATGACGACTCCTTCGAGGAAGAGACTGATGAGGGACTTCAAGAGGCTGCAGCAGGACCCTCCTGCTGGAATCAGTGGTGCTCCCCAAGATAATAATATAC TGCTCTGGAATGCTGTCATATTTGGGCCTGATGACACCCCGTGGGACGGAGGTACGTTTAAGTTAACACTTCAGTTCAGTGAGGACTACCCAAACAAGCC GCCAACAGTACGATTCGTCTCCAGAATGTTCCATCCTAACATTTATGCTGATGGGAGTATTTGCTTGGACATCCTGCAAAACCAATGGAGTCCAATCTAC GACGTTGCTGCGATACTGACCTCAATCCAGTCTCTGCTGTGCGATCCGAACCCTAACTCCCCTGCGAACTCAGAAGCTGCGAGGATGTTCAGCGAGAACA AGCGGGAGTACAACAGGAGAGTGCGAGAGATTGTCGAGCAGAGTTGGACTGCTGATTAA
AA sequence Show only first row Show all	>Lus10036727 pacid=23171297 polypeptide=Lus10036727 locus=Lus10036727.g ID=Lus10036727.BGIv1.0 annot-version=v1.0 MTTPSRKRLMRDFKRLQQDPPAGISGAPQDNNILLWNAVIFGPDDTPWDGGTFKLTLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIY DVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Lus10036727 [exp]	0	1
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Lus10033937 [exp]	1.4	0.8801
AT5G59300		ATUBC7, UBC7	ARABIDOPSIS THALIANA UBIQUITIN...		Lus10016573 [exp]	3.0	0.8518
AT2G31305		INH3	inhibitor-3 (.1)		Lus10022410 [exp]	3.6	0.8071
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10018222 [exp]	7.1	0.7729
AT3G50940			P-loop containing nucleoside t...		Lus10007391 [exp]	9.5	0.7776
AT1G76920			F-box family protein (.1)		Lus10028591 [exp]	11.2	0.8139
AT2G36060		MMZ3 ,UEV1C	UBIQUITIN E2 VARIANT 1C, MMS Z...		Lus10004211 [exp]	11.4	0.7788
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10013373 [exp]	11.7	0.8407
AT5G47200		AtRABD2b, AtRab...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10000595 [exp]	11.8	0.7829
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Lus10011006 [exp]	12.2	0.8348

Compare expression of checked genes

Lus10036727 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.