Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33580 81 / 3e-19 Protein kinase superfamily protein (.1) AT3G01840 45 / 2e-06 Protein kinase superfamily protein (.1) AT2G23770 44 / 3e-06 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT1G16670 42 / 1e-05 Protein kinase superfamily protein (.1) AT1G17540 40 / 4e-05 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032735 [exp] 61 / 5e-12 AT2G23770 305 / 1e-94 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10018788 [exp] 61 / 6e-12 AT2G23770 312 / 3e-97 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10000577 [exp] 60 / 7e-12 AT2G23770 490 / 1e-166 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10019661 [exp] 57 / 7e-11 AT2G23770 483 / 8e-164 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10016299 [exp] 56 / 3e-10 AT2G23770 368 / 3e-119 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10019662 [exp] 40 / 5e-05 AT2G33580 198 / 3e-57 Protein kinase superfamily protein (.1) Lus10021889 [exp] 40 / 8e-05 AT2G23770 256 / 2e-77 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10036363 [exp] 39 / 0.0003 AT2G45910 528 / 9e-178 U-box domain-containing protein kinase family protein (.1) Lus10008586 [exp] 0 / 1 AT2G33580 594 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G259600 [exp] 83 / 4e-20 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.005G128200 [exp] 66 / 4e-14 AT2G23770 514 / 4e-176 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.007G032100 [exp] 61 / 2e-12 AT2G23770 513 / 6e-175 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G040000 [exp] 54 / 8e-10 AT2G23770 345 / 1e-110 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 49 / 4e-08 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.010G078700 [exp] 41 / 3e-05 AT2G23770 288 / 5e-89 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.011G112000 [exp] 39 / 0.0001 AT1G16670 476 / 2e-168 Protein kinase superfamily protein (.1) Potri.001G393200 [exp] 38 / 0.0003 AT1G16670 471 / 2e-165 Protein kinase superfamily protein (.1) Potri.006G128500 [exp] 37 / 0.0005 AT1G16670 353 / 3e-120 Protein kinase superfamily protein (.1) Potri.014G084900 [exp] 37 / 0.0006 AT2G45910 857 / 0.0 U-box domain-containing protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036731 pacid=23171062 polypeptide=Lus10036731 locus=Lus10036731.g ID=Lus10036731.BGIv1.0 annot-version=v1.0 ATGAAGAATGTAGTGGAGGCTTTGACTGTGTACAAGTTTCACGACATAGAGATGGCTACAGATCACTTCAGTCAAGCTAACAAGATCAAAGGCTCAGTAT ACAAATGGATCTTCAAGGGAGATGTTGTTGCGGTGAAGGTGATGAAAGGAGATCTCTCAGCATCACTTGAGCTCAACATCCTGAAGAAGATTAGTCTGTC CAGCGTCATTCGTGTCTCTCTGGATTCTGCATACACGACTGTAATACTTATCTTGTTTATGAGTATGCTGAGAATGGGTCTTTAG
AA sequence Show only first row Show all	>Lus10036731 pacid=23171062 polypeptide=Lus10036731 locus=Lus10036731.g ID=Lus10036731.BGIv1.0 annot-version=v1.0 MKNVVEALTVYKFHDIEMATDHFSQANKIKGSVYKWIFKGDVVAVKVMKGDLSASLELNILKKISLSSVIRVSLDSAYTTVILILFMSMLRMGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33580			Protein kinase superfamily pro...		Lus10036731 [exp]	0	1
AT2G40435			unknown protein		Lus10010217 [exp]	10.6	0.7087
					Lus10009852 [exp]	12.4	0.6876
AT5G20810			SAUR-like auxin-responsive pro...		Lus10034888 [exp]	23.0	0.5961
AT2G18460		LCV3	like COV 3 (.1)		Lus10026023 [exp]	43.7	0.5969
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10000433 [exp]	57.9	0.5992
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Lus10033389 [exp]	72.5	0.5141
AT3G03480		CHAT	acetyl CoA:(Z)-3-hexen-1-ol ac...		Lus10020334 [exp]	91.7	0.5245
AT3G14250			RING/U-box superfamily protein...		Lus10022064 [exp]	117.2	0.5094
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10021074 [exp]	151.9	0.5439

Compare expression of checked genes

Lus10036731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.