Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26940 152 / 3e-47 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G01940 46 / 8e-07 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G63400 46 / 1e-06 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT2G36130 45 / 2e-06 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G15790 43 / 2e-05 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) AT4G33060 42 / 3e-05 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G34870 39 / 0.0003 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT3G44600 39 / 0.0003 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 (.1) AT5G67530 39 / 0.0005 ATPUB49 plant U-box 49 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037197 [exp] 179 / 6e-58 AT1G26940 374 / 1e-133 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10024831 [exp] 52 / 1e-08 AT3G63400 308 / 8e-99 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10018746 [exp] 52 / 1e-08 AT3G63400 306 / 4e-98 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10009237 [exp] 50 / 5e-08 AT1G01940 317 / 2e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10012059 [exp] 49 / 1e-07 AT2G15790 596 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10027924 [exp] 49 / 2e-07 AT2G15790 534 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10009255 [exp] 45 / 2e-06 AT3G62030 164 / 4e-51 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Lus10023860 [exp] 45 / 4e-06 AT2G15790 599 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10020992 [exp] 45 / 5e-06 AT2G15790 598 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G012900 [exp] 156 / 4e-49 AT1G26940 368 / 6e-131 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G215800 [exp] 46 / 1e-06 AT3G63400 252 / 2e-77 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Potri.002G149700 [exp] 45 / 2e-06 AT1G01940 293 / 3e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G071600 [exp] 44 / 3e-06 AT1G01940 293 / 2e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G075600 [exp] 44 / 6e-06 AT2G36130 278 / 3e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G144300 [exp] 44 / 8e-06 AT2G15790 590 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.002G047200 [exp] 44 / 1e-05 AT3G63400 229 / 1e-66 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Potri.009G106200 [exp] 43 / 2e-05 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.005G135500 [exp] 42 / 3e-05 AT2G15790 553 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.002G185200 [exp] 42 / 4e-05 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [flax] [poplar] Cyclophil-like PF00160 [flax] [poplar] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Lus10036733 pacid=23171326 polypeptide=Lus10036733 locus=Lus10036733.g ID=Lus10036733.BGIv1.0 annot-version=v1.0 ATGAATGAAGAGCAAAGACTGGAGGCAGAGAAGACTGTGATTGGTGAATTTAGTGACGTTAAGCATGTTCGAGGCATCCTGTCCATGGGGAGGTATGCTG ATCCAAACAGTGGATCTTCCTCGTTTTCAATCCTACTTGGGAATGCACCTCATCTGGACGGCCAATATGCAATATTTGGTAAAGTTACTAAAGGTGATGA CACATTAACGAAGCTGGAGCAGCTTCCTACCCGGACTGAGGGAATCTTTGTGATGTCTTTACTGTCTCCTTTGACCATATGCGCTCCAAAATGTTCAATT GTGCACTCGTCCAAACACGTTCCTGGTTCACTCTCATCTCCTCTCCTTTCTGATGTAACATCCTTCAATTTACTTGTCGTTACGGTCACTAAATGA
AA sequence Show only first row Show all	>Lus10036733 pacid=23171326 polypeptide=Lus10036733 locus=Lus10036733.g ID=Lus10036733.BGIv1.0 annot-version=v1.0 MNEEQRLEAEKTVIGEFSDVKHVRGILSMGRYADPNSGSSSFSILLGNAPHLDGQYAIFGKVTKGDDTLTKLEQLPTRTEGIFVMSLLSPLTICAPKCSI VHSSKHVPGSLSSPLLSDVTSFNLLVVTVTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26940			Cyclophilin-like peptidyl-prol...		Lus10036733 [exp]	0	1
AT4G39150			DNAJ heat shock N-terminal dom...		Lus10017472 [exp]	3.0	0.7912
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Lus10040677 [exp]	3.5	0.7624
AT1G63430			Leucine-rich repeat protein ki...		Lus10008310 [exp]	13.0	0.7717
AT5G36930			Disease resistance protein (TI...		Lus10026961 [exp]	16.1	0.7794
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10008555 [exp]	16.6	0.7782
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10043373 [exp]	18.3	0.7540
AT1G78210			alpha/beta-Hydrolases superfam...		Lus10020926 [exp]	20.2	0.7450
AT5G35170			adenylate kinase family protei...		Lus10019071 [exp]	28.7	0.7447
AT1G17930			Aminotransferase-like, plant m...		Lus10000686 [exp]	32.4	0.7775
AT2G41290		SSL2	strictosidine synthase-like 2 ...		Lus10012095 [exp]	32.8	0.7768

Compare expression of checked genes

Lus10036733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.