Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54490 106 / 3e-31 PBP1 pinoid-binding protein 1 (.1) AT4G27280 105 / 6e-31 Calcium-binding EF-hand family protein (.1) AT2G46600 100 / 8e-29 Calcium-binding EF-hand family protein (.1) AT5G37780 48 / 3e-08 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT1G66410 48 / 3e-08 ACAM-4, CAM4 calmodulin 4 (.1.2) AT5G21274 48 / 5e-08 ACAM-6, CAM6 calmodulin 6 (.1) AT3G43810 47 / 1e-07 CAM7 calmodulin 7 (.1) AT3G50360 47 / 2e-07 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) AT2G27030 45 / 2e-07 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT3G56800 45 / 4e-07 ACAM-3, CAM3 calmodulin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033753 [exp] 172 / 1e-57 AT4G27280 133 / 3e-41 Calcium-binding EF-hand family protein (.1) Lus10031588 [exp] 171 / 4e-57 AT4G27280 133 / 3e-41 Calcium-binding EF-hand family protein (.1) Lus10018511 [exp] 147 / 1e-47 AT4G27280 140 / 2e-44 Calcium-binding EF-hand family protein (.1) Lus10039724 [exp] 146 / 3e-47 AT4G27280 139 / 1e-43 Calcium-binding EF-hand family protein (.1) Lus10030227 [exp] 98 / 6e-28 AT2G46600 167 / 1e-54 Calcium-binding EF-hand family protein (.1) Lus10005985 [exp] 98 / 6e-28 AT2G46600 167 / 1e-54 Calcium-binding EF-hand family protein (.1) Lus10014709 [exp] 48 / 4e-08 AT4G14640 162 / 4e-52 calmodulin-like 8, calmodulin 8 (.1) Lus10014708 [exp] 47 / 6e-08 AT4G14640 163 / 2e-52 calmodulin-like 8, calmodulin 8 (.1) Lus10027283 [exp] 47 / 1e-07 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G151000 [exp] 136 / 4e-43 AT5G54490 147 / 7e-47 pinoid-binding protein 1 (.1) Potri.019G120600 [exp] 135 / 1e-42 AT5G54490 147 / 6e-47 pinoid-binding protein 1 (.1) Potri.011G129100 [exp] 116 / 2e-35 AT4G27280 124 / 5e-38 Calcium-binding EF-hand family protein (.1) Potri.011G039500 [exp] 114 / 3e-34 AT4G27280 127 / 6e-39 Calcium-binding EF-hand family protein (.1) Potri.011G039600 [exp] 114 / 3e-34 AT4G27280 127 / 6e-39 Calcium-binding EF-hand family protein (.1) Potri.001G412077 [exp] 110 / 1e-32 AT4G27280 117 / 4e-35 Calcium-binding EF-hand family protein (.1) Potri.004G027200 [exp] 108 / 5e-32 AT5G54490 127 / 3e-39 pinoid-binding protein 1 (.1) Potri.014G101700 [exp] 102 / 2e-29 AT2G46600 181 / 3e-60 Calcium-binding EF-hand family protein (.1) Potri.002G174900 [exp] 99 / 4e-28 AT2G46600 174 / 4e-57 Calcium-binding EF-hand family protein (.1) Potri.001G414600 [exp] 97 / 2e-27 AT5G54490 118 / 1e-35 pinoid-binding protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036734 pacid=23171040 polypeptide=Lus10036734 locus=Lus10036734.g ID=Lus10036734.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCAAAGCTAGGCGATTTCGAAGATTTGCTCCCGGTGATGGCGGATAAACTAGGCGGGGAAGGTCTAATCAGGGAGCTCTGCAATGGGTTCC AGTTGTTGGTCGATAAGGACAGAGGGGTGATAACACCGGCGAACTTGCGCCTGAACGCCGCGGTGCTGGGCTTGCAGGACTTGTCGGAAGGGGAGATCGC CGGGATGGTTAGAGAAGGGGATCTTGACGGCGATGGAGCATTGGATCAGATGAGTTTTTGTGTTTTGATGTTCGATTGA
AA sequence Show only first row Show all	>Lus10036734 pacid=23171040 polypeptide=Lus10036734 locus=Lus10036734.g ID=Lus10036734.BGIv1.0 annot-version=v1.0 MAAAKLGDFEDLLPVMADKLGGEGLIRELCNGFQLLVDKDRGVITPANLRLNAAVLGLQDLSEGEIAGMVREGDLDGDGALDQMSFCVLMFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G54490		PBP1	pinoid-binding protein 1 (.1)		Lus10036734 [exp]	0	1
AT3G57450			unknown protein		Lus10035455 [exp]	1.4	0.9169
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	4.5	0.9049
AT4G27280			Calcium-binding EF-hand family...		Lus10033753 [exp]	5.1	0.9169
AT4G11170			Disease resistance protein (TI...		Lus10010222 [exp]	5.3	0.9000
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	6.7	0.8882
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10024263 [exp]	7.3	0.9084
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10022005 [exp]	7.4	0.9020
AT4G28400			Protein phosphatase 2C family ...		Lus10028094 [exp]	9.5	0.9006
AT5G39670			Calcium-binding EF-hand family...		Lus10042369 [exp]	9.8	0.8925
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Lus10025971 [exp]	12.3	0.8707

Compare expression of checked genes

Lus10036734 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.