Lus10036750 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26880 181 / 2e-60 Ribosomal protein L34e superfamily protein (.1.2)
AT1G69620 179 / 2e-59 RPL34 ribosomal protein L34 (.1)
AT3G28900 175 / 3e-58 Ribosomal protein L34e superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042199 189 / 9e-64 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10037177 189 / 9e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10012829 189 / 1e-63 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10030477 189 / 1e-63 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10008617 187 / 1e-62 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G082200 185 / 6e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2)
Potri.012G108400 185 / 6e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2)
Potri.015G106466 184 / 1e-61 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2)
Potri.015G106532 184 / 1e-61 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2)
Potri.001G195101 176 / 2e-58 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2)
Potri.004G029400 165 / 7e-54 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2)
Potri.012G108301 105 / 4e-31 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01199 Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence
>Lus10036750 pacid=23171235 polypeptide=Lus10036750 locus=Lus10036750.g ID=Lus10036750.BGIv1.0 annot-version=v1.0
ATGGCTCAGCGGCTCACTTACCGTAAGCGCCATAGCTACGCCACCAAGTCCAACCAGCACAGGATTGTCAAAACTCCAGGTGGGAAGTTGGTGTATCAGA
CCACTAAGAAGAGGGCCAGCGGACCGAAATGCCCTGTTACTGGGAAGAGGATTCAAGGGATTCCCCACTTGAGACCTGCTGAGTACAAGAGGTCAAGATT
GCCAAGGAACAGGAGGACTGTGAACCGTGCCTATGGAGGAGTTCTTTCTGGTGGTGCTGTCAGAGAAAGGATCATCCGTGCCTTCCTTGTCGAAGAACAA
AAGATTGTGAAGAAGGTCCTGAAGATCCAAAAATCCAAGGAAAAGGTCACCAAGAGCTAA
AA sequence
>Lus10036750 pacid=23171235 polypeptide=Lus10036750 locus=Lus10036750.g ID=Lus10036750.BGIv1.0 annot-version=v1.0
MAQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQ
KIVKKVLKIQKSKEKVTKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 0 1
AT3G52570 alpha/beta-Hydrolases superfam... Lus10021315 1.0 0.9420
AT3G53740 Ribosomal protein L36e family ... Lus10016501 1.4 0.9358
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 2.4 0.9054
AT5G65860 ankyrin repeat family protein ... Lus10032850 3.0 0.8954
AT3G23390 Zinc-binding ribosomal protein... Lus10013436 3.5 0.9279
AT5G27470 seryl-tRNA synthetase / serine... Lus10017409 3.7 0.8867
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Lus10027926 3.7 0.9026
AT2G20450 Ribosomal protein L14 (.1) Lus10024918 3.9 0.9060
AT2G19740 Ribosomal protein L31e family ... Lus10042028 4.0 0.9255
AT2G18196 Heavy metal transport/detoxifi... Lus10010147 4.0 0.8973

Lus10036750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.