Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037168 [exp] 79 / 1e-20 ND 33 / 0.005
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036759 pacid=23171245 polypeptide=Lus10036759 locus=Lus10036759.g ID=Lus10036759.BGIv1.0 annot-version=v1.0 ATGGACACCCTTTATCTTCCCCGGAGACGCAGAAGGTTGGGAGAAGGTTTGGGCATGGCAGAGTGGAAGTGGAACTGGAGGATTATGCTGGGTCAGGAGC AAACGACCGCCACACGCCGCCGAAGCCCACCACCGGCGGAGCTTAACTGCTTTCCGATCAGATCCAGTATGGAATTAAAGAATAAGGAGGGGAAACAGAT TTGTGGTTATCGGGATCTTGATAAAAAGGTGGTGGGAAGATGTGAAGAGAAAGTGGAAAGTTGA
AA sequence Show only first row Show all	>Lus10036759 pacid=23171245 polypeptide=Lus10036759 locus=Lus10036759.g ID=Lus10036759.BGIv1.0 annot-version=v1.0 MDTLYLPRRRRRLGEGLGMAEWKWNWRIMLGQEQTTATRRRSPPPAELNCFPIRSSMELKNKEGKQICGYRDLDKKVVGRCEEKVES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036759 [exp]	0	1
AT1G53910	AP2_ERF	RAP2.12	related to AP2 12 (.1.2.3)		Lus10037448 [exp]	2.4	0.8719
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10039562 [exp]	3.7	0.8597
AT2G34930			disease resistance family prot...		Lus10024737 [exp]	6.0	0.7868
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10024177 [exp]	7.2	0.8206
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Lus10021551 [exp]	9.4	0.7888
AT2G20740			Tetraspanin family protein (.1...		Lus10039817 [exp]	9.9	0.8400
AT1G53910	AP2_ERF	RAP2.12	related to AP2 12 (.1.2.3)		Lus10013186 [exp]	13.0	0.8184
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Lus10007193 [exp]	13.0	0.7075
AT5G10530			Concanavalin A-like lectin pro...		Lus10029553 [exp]	13.0	0.8021
AT1G08315			ARM repeat superfamily protein...		Lus10024145 [exp]	13.6	0.7985

Compare expression of checked genes

Lus10036759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.