Lus10036765 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023847 246 / 3e-77 AT2G15900 606 / 0.0 Phox-associated domain;Phox-like;Sorting nexin, C-terminal (.1)
Lus10027939 160 / 3e-46 AT2G15900 1001 / 0.0 Phox-associated domain;Phox-like;Sorting nexin, C-terminal (.1)
Lus10012042 67 / 3e-13 AT2G15900 495 / 9e-167 Phox-associated domain;Phox-like;Sorting nexin, C-terminal (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G108300 64 / 1e-12 AT2G15900 1117 / 0.0 Phox-associated domain;Phox-like;Sorting nexin, C-terminal (.1)
Potri.004G146600 59 / 2e-10 AT2G15900 1073 / 0.0 Phox-associated domain;Phox-like;Sorting nexin, C-terminal (.1)
PFAM info
Representative CDS sequence
>Lus10036765 pacid=23171121 polypeptide=Lus10036765 locus=Lus10036765.g ID=Lus10036765.BGIv1.0 annot-version=v1.0
ATGGGAAAAGAATCACCATCTACTGGTACTGTGATTCCCACAAGAACACATGGAAAAGTTTCTGGGTTCCTAACACCTCAAGCAAATGTTGATCATGCGT
TAGTCAATGAGAAGGAAAATGAAAAACATATAGTAGCAGGTCAGAGTAGTGAGTACTTTGCAGGAGTTGGTACTATTGATGAATCTCAGACTACCACCAA
GCATTCAATGAATGAAAATGTGGGCAAGCTTAAGCGGTCAAATAGCACTTCAGCTTTGAGAAATCAGCCTGAAAAGAAGAGGGCATTGGAACCGGAACAT
GCAAGTTCCATTATCTCAGAGTACAGTGCAGATTTTGTTGGGCATGCTTTGGATTCTGCTGTTAAATTCATACCTGATAAAGTATTGCGCATTGACTCAA
CTAATGTTCCAAAGCTTCAAGCTACGGTGGTGATTTCACTTGGAATGCAGGCAAGATACAATGGGTACTGA
AA sequence
>Lus10036765 pacid=23171121 polypeptide=Lus10036765 locus=Lus10036765.g ID=Lus10036765.BGIv1.0 annot-version=v1.0
MGKESPSTGTVIPTRTHGKVSGFLTPQANVDHALVNEKENEKHIVAGQSSEYFAGVGTIDESQTTTKHSMNENVGKLKRSNSTSALRNQPEKKRALEPEH
ASSIISEYSADFVGHALDSAVKFIPDKVLRIDSTNVPKLQATVVISLGMQARYNGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10036765 0 1
AT5G15630 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4... Lus10021142 1.0 1.0000
AT2G16190 unknown protein Lus10011284 2.0 1.0000
AT3G54200 Late embryogenesis abundant (L... Lus10031554 2.4 1.0000
Lus10006395 2.8 1.0000
AT3G55500 ATHEXPALPHA1.7,... EXPANSIN 16, expansin A16 (.1) Lus10014406 3.2 0.9852
AT4G39250 MYB RSM2, ATRL1 RADIALIS-LIKE SANT/MYB 2, RAD-... Lus10023568 3.5 0.9794
AT3G56710 SIB1 sigma factor binding protein 1... Lus10026165 3.7 0.9791
Lus10038080 4.2 0.9712
Lus10027005 5.1 0.9644
AT5G04885 Glycosyl hydrolase family prot... Lus10019385 5.3 0.9641

Lus10036765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.