Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64130 103 / 1e-29 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT1G69510 99 / 1e-27 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT4G16146 72 / 1e-17 cAMP-regulated phosphoprotein 19-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037162 [exp] 144 / 4e-41 AT1G69523 268 / 4e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10030448 [exp] 121 / 4e-36 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10026615 [exp] 121 / 4e-36 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10009146 [exp] 91 / 1e-24 AT5G64130 150 / 2e-48 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10028499 [exp] 90 / 3e-24 AT5G64130 143 / 2e-45 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10037727 [exp] 68 / 2e-14 AT5G49350 136 / 1e-38 Glycine-rich protein family (.1.2) Lus10016857 [exp] 65 / 1e-13 AT5G49350 138 / 3e-40 Glycine-rich protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G167000 [exp] 111 / 5e-32 AT1G69510 104 / 4e-29 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.017G102700 [exp] 107 / 4e-31 AT5G64130 159 / 1e-51 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.004G111900 [exp] 106 / 6e-31 AT5G64130 152 / 4e-49 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.008G108201 [exp] 78 / 6e-20 AT4G16146 103 / 4e-30 cAMP-regulated phosphoprotein 19-related protein (.1) Potri.010G141300 [exp] 76 / 4e-19 AT4G16146 105 / 3e-31 cAMP-regulated phosphoprotein 19-related protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04667 [flax] [poplar] Endosulfine cAMP-regulated phosphoprotein/endosulfine conserved region
Representative CDS sequence Show only first row Show all	>Lus10036768 pacid=23171164 polypeptide=Lus10036768 locus=Lus10036768.g ID=Lus10036768.BGIv1.0 annot-version=v1.0 ATGTCGAGCGGTGGAGATCCAAACCCATCTCCCTCTCAGGCGCAGGAGGAGCAAATACTGAAGAGCAAGTATGGAGGGATCTTACCCAAGAAGAAGCCAT TGATTTCCAAGGATCATGAGCGTGCTTTTTTCGACTCTGCAGATTGGGCACTGGGAAAGGGGGCGCAAAAGCCTAAAGGGCCACTTGAAGCACTCCGCCC CAAGTTACAGCCGACTAGATCCAGGCAGCAGTCGTCGAGATCCAGGCGATCGGCATATGCTCCTGGCAATGAGGACGAAGTGGACGGCGCTGGGGAAGCA GCTGGTGAGTCTGTTGAAGGAGGAGGAGGAACCGAGGAGCAGAGCAGCCATGGTCAACCCTGA
AA sequence Show only first row Show all	>Lus10036768 pacid=23171164 polypeptide=Lus10036768 locus=Lus10036768.g ID=Lus10036768.BGIv1.0 annot-version=v1.0 MSSGGDPNPSPSQAQEEQILKSKYGGILPKKKPLISKDHERAFFDSADWALGKGAQKPKGPLEALRPKLQPTRSRQQSSRSRRSAYAPGNEDEVDGAGEA AGESVEGGGGTEEQSSHGQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10036768 [exp]	0	1
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10000404 [exp]	2.8	0.7800
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Lus10042450 [exp]	3.7	0.7246
AT4G08520			SNARE-like superfamily protein...		Lus10037624 [exp]	5.1	0.7632
AT5G62930			SGNH hydrolase-type esterase s...		Lus10027675 [exp]	7.5	0.7456
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Lus10013651 [exp]	7.7	0.7377
AT4G01897			unknown protein		Lus10038061 [exp]	8.3	0.7518
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10032612 [exp]	11.0	0.6711
AT1G12310			Calcium-binding EF-hand family...		Lus10032205 [exp]	12.5	0.7071
AT1G63610			unknown protein		Lus10013233 [exp]	12.8	0.7007
AT3G55770	LIM	WLIM2b	WLIM2b, GATA type zinc finger ...		Lus10028257 [exp]	13.1	0.6918

Compare expression of checked genes

Lus10036768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.