Lus10036771 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18720 223 / 1e-74 Protein of unknown function (DUF962) (.1)
AT1G74440 213 / 1e-70 Protein of unknown function (DUF962) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030447 281 / 2e-97 AT1G18720 256 / 2e-87 Protein of unknown function (DUF962) (.1)
Lus10001646 195 / 3e-63 AT1G18720 246 / 3e-83 Protein of unknown function (DUF962) (.1)
Lus10021661 186 / 9e-60 AT1G18720 242 / 8e-82 Protein of unknown function (DUF962) (.1)
Lus10021660 145 / 7e-44 AT1G18720 174 / 3e-55 Protein of unknown function (DUF962) (.1)
Lus10037158 120 / 2e-35 AT1G18720 92 / 2e-24 Protein of unknown function (DUF962) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G088800 262 / 8e-90 AT1G18720 245 / 4e-83 Protein of unknown function (DUF962) (.1)
Potri.010G166500 241 / 1e-81 AT1G18720 251 / 2e-85 Protein of unknown function (DUF962) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06127 DUF962 Protein of unknown function (DUF962)
Representative CDS sequence
>Lus10036771 pacid=23171132 polypeptide=Lus10036771 locus=Lus10036771.g ID=Lus10036771.BGIv1.0 annot-version=v1.0
ATGGCGAGGTTGTCGTTGTTTGATCTAGAGCGACACTTCGCCTTCTACGGAGCATACCACAGCAACCCAACCAACGTATTGATTCACATGATATTCGTCT
GGCCGATTCTCTTCGCTACCCTTCTAATTCTCCACTTCACCCCTCCTTTATTATCCATCAACATTCACCTCTTCCCTCTCAATTCCTTCCTTGTTTTCAA
CGTTGGCTTCTTGCTGACCTTTATCTATGGCTTCTTCTACATCTGCTTGGATAAGAAAGCTGGTTCCTTGGCTGCATTGATCTTGCTCTTCTGTCTGTTT
GCTAGTAGCTTCCTGGGTTCTTGGCTTGGTTTCTCACTTGCTTGGAAGGTGGTTGTGGTTGCTCAGATTGTATGCTGGACTGGACAGTTCATTGGACATG
GGGTGTTTGAGAAACGAGCTCCGGCTTTATTGGACAACCTTATTCAAGCCTTTGTAATGGCTCCCTTCTTTGTGCTGTTGGAGGCTCTACAAACCTTCTT
TGGTTATGAACCGTACCCTGGATTTCACGAAACTGTGCAAGCTAAGGTCGATGCCGAGATCCGTGAATGGCAAGAGAAGAAGAAAAAGAAGTCAACTTGA
AA sequence
>Lus10036771 pacid=23171132 polypeptide=Lus10036771 locus=Lus10036771.g ID=Lus10036771.BGIv1.0 annot-version=v1.0
MARLSLFDLERHFAFYGAYHSNPTNVLIHMIFVWPILFATLLILHFTPPLLSINIHLFPLNSFLVFNVGFLLTFIYGFFYICLDKKAGSLAALILLFCLF
ASSFLGSWLGFSLAWKVVVVAQIVCWTGQFIGHGVFEKRAPALLDNLIQAFVMAPFFVLLEALQTFFGYEPYPGFHETVQAKVDAEIREWQEKKKKKST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18720 Protein of unknown function (D... Lus10036771 0 1
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Lus10013897 2.6 0.8961
AT2G06530 VPS2.1 SNF7 family protein (.1) Lus10037660 4.5 0.8908
AT2G43210 Ubiquitin-like superfamily pro... Lus10026718 8.9 0.8844
AT3G08840 D-alanine--D-alanine ligase fa... Lus10012211 9.8 0.8850
AT1G03250 unknown protein Lus10028017 14.0 0.8697
AT3G05010 Protein of unknown function, t... Lus10018985 14.5 0.8710
AT4G27040 VPS22 EAP30/Vps36 family protein (.1... Lus10002292 22.9 0.8249
AT1G14820 Sec14p-like phosphatidylinosit... Lus10003699 23.0 0.8432
AT3G43230 RING/FYVE/PHD-type zinc finger... Lus10039922 23.0 0.8783
AT4G21760 BGLU47 beta-glucosidase 47 (.1) Lus10000225 24.1 0.8411

Lus10036771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.