Lus10036790 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10036790 pacid=23171249 polypeptide=Lus10036790 locus=Lus10036790.g ID=Lus10036790.BGIv1.0 annot-version=v1.0
ATGTTGGTGGTCAATGCTTACCCGGTGGACAGTTGGCTAGATCCTGCTAGCAGACGGTTGAGGAAAATGCAGAGAAGATTTCAGCACTTTCTTACGATTG
CTGCGGCTTTCTCTTGCAGAGAGGTGCATTTACTCACTTTGTGCTTGGTTGAGTATGCTCAAAGTCTTTCTCGATCTTCCTCCGTAGTCCGTATATTCAC
TTTCTTCTCACAGTTCAATTCTTCCTCGTTCTCGCTGTGTGCTGCAACGGAGTTCTACGGTAGAGCTAGTGAGCGGGAGCCAAATTGTCAGAGAGATAGA
GAGAACACAAGCTGTCGCTGCCGGCTGCTGCCTTCGATCACTCGATCCGCTCCACAGTCGGGCGAGCAATTCCAATATTCCATCACCCGATCTGTTCAAC
TCCAAGCTTCCGCCCACTCGGTGCAGAATTCTGGCTCCCAGTACGATGAGTAA
AA sequence
>Lus10036790 pacid=23171249 polypeptide=Lus10036790 locus=Lus10036790.g ID=Lus10036790.BGIv1.0 annot-version=v1.0
MLVVNAYPVDSWLDPASRRLRKMQRRFQHFLTIAAAFSCREVHLLTLCLVEYAQSLSRSSSVVRIFTFFSQFNSSSFSLCAATEFYGRASEREPNCQRDR
ENTSCRCRLLPSITRSAPQSGEQFQYSITRSVQLQASAHSVQNSGSQYDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10036790 0 1
AT4G39420 unknown protein Lus10014010 4.9 0.8657
AT4G31570 unknown protein Lus10026934 5.2 0.9005
AT1G47670 Transmembrane amino acid trans... Lus10003339 5.7 0.8849
AT4G31570 unknown protein Lus10020133 11.8 0.8878
AT2G15900 Phox-associated domain;Phox-li... Lus10012043 13.0 0.8851
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10004179 13.4 0.8228
AT5G20950 Glycosyl hydrolase family prot... Lus10023604 13.9 0.8272
AT5G59990 CCT motif family protein (.1.2... Lus10028137 14.1 0.8471
AT2G40460 Major facilitator superfamily ... Lus10034206 14.9 0.8209
AT3G08040 ATFRD3, MAN1, F... MANGANESE ACCUMULATOR 1, FERRI... Lus10039609 15.7 0.8169

Lus10036790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.