Lus10036802 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69390 230 / 1e-76 ARC12, ATMINE1 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037128 401 / 7e-144 AT1G69390 256 / 2e-86 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10026638 286 / 2e-98 AT1G69390 247 / 4e-83 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10030421 283 / 4e-97 AT1G69390 248 / 9e-84 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G162600 275 / 8e-94 AT1G69390 272 / 5e-93 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.008G092300 270 / 2e-92 AT1G69390 270 / 2e-92 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.004G121000 163 / 2e-50 AT1G69390 191 / 2e-61 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.017G088401 87 / 2e-22 AT1G69390 86 / 2e-22 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03776 MinE Septum formation topological specificity factor MinE
Representative CDS sequence
>Lus10036802 pacid=23170992 polypeptide=Lus10036802 locus=Lus10036802.g ID=Lus10036802.BGIv1.0 annot-version=v1.0
ATGGCGATTTCATCAGGGGATCTGAGGGTCTCTGCAACTTTGGCATCATTCCATAATCATCCATTTACAAGATCGCATTCTTCTTCCACTTCGAAGGTGG
ACTTCATTGCATTCCCCAGCACAAGATCCGGAACCAATTCTCCACCTGCAATCATCTTTCCAAATCCTAAGCCGCATGGTCCCATCTATCGATCTGCTGC
ACCTTCTTCGGATTATCAGCTGTCCACAACATCAATAGACGAAGAAGACACAGAAATCTTCCTTCTCAGCACCATAAACATGAACCTCTTCGAACGCTTG
ACCTTAGCCTGGAAGATAATCTTCCCATCTCCCGCCAGAAGAAGGAGCTCGAATGCTAGGATTGCCAAGCAGCGGCTAAAGATGATCCTCTTCTCCGACC
GGTGTGCAGTCAGCGACGAGGCCAAGAGGAAGATCGTGGGCAACATTGTAAATTCACTCTCAGAGGTTGTCGAGATCGAGTCTCAGGACAAAGTCCAGCT
GAATGTGAGTACCGACACGGACCTTGGGACCATGTACTCCGTAACGGTACCGGTTCGCAGGGTGAAGGCTGAGTATCTAGAGGGGGAAGAGATTGGATCC
ATAACGAACATTGAGTACAAAGACACTGGCAACCAATCTGAATCGGTCGATGTCATGTTCGATTTCTATGTCCCTGACGAAAGGTCTCGGTGA
AA sequence
>Lus10036802 pacid=23170992 polypeptide=Lus10036802 locus=Lus10036802.g ID=Lus10036802.BGIv1.0 annot-version=v1.0
MAISSGDLRVSATLASFHNHPFTRSHSSSTSKVDFIAFPSTRSGTNSPPAIIFPNPKPHGPIYRSAAPSSDYQLSTTSIDEEDTEIFLLSTINMNLFERL
TLAWKIIFPSPARRRSSNARIAKQRLKMILFSDRCAVSDEAKRKIVGNIVNSLSEVVEIESQDKVQLNVSTDTDLGTMYSVTVPVRRVKAEYLEGEEIGS
ITNIEYKDTGNQSESVDVMFDFYVPDERSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10036802 0 1
AT3G54560 HTA11 histone H2A 11 (.1) Lus10014717 1.0 0.9106
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10037128 2.8 0.8880
Lus10035688 5.5 0.8793
AT3G20390 endoribonuclease L-PSP family ... Lus10021523 5.7 0.8780
AT2G45850 AT-hook AT hook motif DNA-binding fami... Lus10037858 6.9 0.8657
AT2G45250 Integral membrane protein hemo... Lus10003319 7.5 0.8544
AT3G07360 ATPUB9 ARABIDOPSIS THALIANA PLANT U-B... Lus10020413 8.8 0.8416
AT1G75080 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Bras... Lus10014327 9.8 0.8415
AT5G54980 Uncharacterised protein family... Lus10034604 11.3 0.8394
AT3G53730 Histone superfamily protein (.... Lus10004949 11.4 0.8695

Lus10036802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.