Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69180 179 / 5e-58 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT2G45190 134 / 1e-39 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT1G08465 124 / 2e-36 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G26580 122 / 5e-36 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G23420 94 / 4e-24 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 81 / 4e-19 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000644 [exp] 248 / 8e-85 AT1G69180 177 / 5e-57 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 120 / 7e-34 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10032240 [exp] 117 / 4e-33 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10019407 [exp] 112 / 1e-31 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10043264 [exp] 108 / 1e-27 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10010361 [exp] 94 / 7e-24 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10029135 [exp] 92 / 2e-23 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10036496 [exp] 76 / 2e-17 AT2G45190 183 / 2e-58 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10030596 [exp] 77 / 4e-17 AT1G23420 194 / 8e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G097800 [exp] 199 / 5e-66 AT1G69180 157 / 3e-49 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Potri.010G154350 [exp] 191 / 1e-62 AT1G69180 155 / 2e-48 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 134 / 8e-40 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.009G000100 [exp] 129 / 1e-38 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 130 / 3e-38 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 128 / 5e-38 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.006G067800 [exp] 127 / 1e-37 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.001G120200 [exp] 127 / 3e-37 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 121 / 9e-35 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.016G067300 [exp] 111 / 2e-31 AT1G08465 150 / 2e-46 YABBY2, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10036811 pacid=23171312 polypeptide=Lus10036811 locus=Lus10036811.g ID=Lus10036811.BGIv1.0 annot-version=v1.0 ATGAACATGAACCAGCAGCAGCAGCAGGAAGAGAAAGTGACGATGGACCTGATCCCGCCCTCCGACCACCTCTGCTACGTCCGATGCAACTTCTGCAACA CGGTCCTCGCTGTCGGGATACCGTACAAGAGGCTTCTTGACACCGTCACTGTCAAGTGCGGCCACTGCAGCAACCTCTCCTTCCTCAGCACTCGCCCTCC TCTCCAAGGCCAGTGCCTCAACGACCACCAGTACCCCCACCTCTCCCTTCAGCCACTCTCTCCCAAGGCTCCCTTTGTAGTCAAACCGCCGGAGAAGAAG CACCGGCTTCCGTCTGCTTACAACCGCTTCATGAGGGAGGAGATCCAGAGGATCAAGTCTGCAAACCCTGAGATACCACACAGGGAGGCTTTCAGTGCTG CAGCCAAAAATTGGGCAAGGTACATTCCAACTTCAGCGGGAGCTGCCGGGTCATCAGTCTCAGGGAGCAATACCAATAGTGGGTTGCATTTTGCAGGGAT GAGGTGA
AA sequence Show only first row Show all	>Lus10036811 pacid=23171312 polypeptide=Lus10036811 locus=Lus10036811.g ID=Lus10036811.BGIv1.0 annot-version=v1.0 MNMNQQQQQEEKVTMDLIPPSDHLCYVRCNFCNTVLAVGIPYKRLLDTVTVKCGHCSNLSFLSTRPPLQGQCLNDHQYPHLSLQPLSPKAPFVVKPPEKK HRLPSAYNRFMREEIQRIKSANPEIPHREAFSAAAKNWARYIPTSAGAAGSSVSGSNTNSGLHFAGMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Lus10036811 [exp]	0	1
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10043023 [exp]	1.4	0.9581
AT5G41460			Protein of unknown function (D...		Lus10018123 [exp]	1.7	0.9687
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Lus10007645 [exp]	3.9	0.9478
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10001543 [exp]	4.2	0.9289
AT3G54860		ATVPS33	VACUOLAR PROTEIN SORTING 33, S...		Lus10002776 [exp]	4.5	0.9166
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008921 [exp]	5.3	0.9425
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008534 [exp]	5.5	0.9315
AT3G53810			Concanavalin A-like lectin pro...		Lus10001564 [exp]	8.7	0.8736
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10034971 [exp]	37.0	0.9274
AT1G02050		LAP6	LESS ADHESIVE POLLEN 6, Chalco...		Lus10039904 [exp]	39.7	0.8902

Compare expression of checked genes

Lus10036811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.