Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03720 109 / 7e-32 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G69080 109 / 2e-31 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT5G17390 100 / 4e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03290 95 / 4e-25 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G44760 59 / 8e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G13450 54 / 5e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019173 [exp] 181 / 2e-59 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 112 / 3e-32 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007982 [exp] 100 / 5e-27 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029664 [exp] 65 / 5e-14 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10042701 [exp] 64 / 7e-14 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025644 [exp] 62 / 5e-13 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10018190 [exp] 57 / 3e-11 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10043152 [exp] 52 / 5e-09 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10023716 [exp] 50 / 5e-09 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T170801 [exp] 155 / 4e-49 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.008G109000 [exp] 155 / 5e-49 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G140200 [exp] 152 / 9e-48 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.015G060700 [exp] 122 / 3e-36 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G084600 [exp] 72 / 1e-16 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G177100 [exp] 69 / 1e-15 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G064800 [exp] 62 / 5e-13 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10036814 pacid=23171093 polypeptide=Lus10036814 locus=Lus10036814.g ID=Lus10036814.BGIv1.0 annot-version=v1.0 ATGGAAGGGAAGGAGAAAGGTCCAGCAATATTTGAAGAAGCAAAGAAGCAACGCGTAGCGCTGCTGGTACTTGGCCAGAGGAAGAGATCTTCGATGACGT GGCGGCTGATCATGATGTGGGCCAGCAGTAAAGTCAATGCAGCCGGCGGCGGCGGGGTGGTGGAGTATTGTATCCAGAATGCAGAGTGCATGGCGATCAC CGTCCGGCGGAAGAGCAAGAAACATGGCGGCTACTTGATCACCACTAAACGCCACAAGGATTTCTGGCTCTTAGCCTAA
AA sequence Show only first row Show all	>Lus10036814 pacid=23171093 polypeptide=Lus10036814 locus=Lus10036814.g ID=Lus10036814.BGIv1.0 annot-version=v1.0 MEGKEKGPAIFEEAKKQRVALLVLGQRKRSSMTWRLIMMWASSKVNAAGGGGVVEYCIQNAECMAITVRRKSKKHGGYLITTKRHKDFWLLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69080			Adenine nucleotide alpha hydro...		Lus10036814 [exp]	0	1
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10018674 [exp]	2.6	0.8165
AT3G50780			unknown protein		Lus10022484 [exp]	5.7	0.7950
AT5G44440			FAD-binding Berberine family p...		Lus10023367 [exp]	9.2	0.7688
AT1G30700			FAD-binding Berberine family p...		Lus10038439 [exp]	9.8	0.7748
AT3G21870		CYCP2;1	cyclin p2;1 (.1)		Lus10027148 [exp]	13.5	0.7947
AT3G06240			F-box family protein (.1)		Lus10007040 [exp]	13.8	0.6464
AT1G31420		FEI1	FEI 1, Leucine-rich repeat pro...		Lus10034739 [exp]	14.3	0.7517
AT5G44005			unknown protein		Lus10008220 [exp]	15.7	0.7619
AT5G47740			Adenine nucleotide alpha hydro...		Lus10019487 [exp]	16.9	0.7467
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10007748 [exp]	17.3	0.7611

Compare expression of checked genes

Lus10036814 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.