Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14610 208 / 3e-64 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14630 204 / 1e-62 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14620 197 / 5e-60 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14690 191 / 9e-58 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14680 191 / 1e-57 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT2G26710 189 / 4e-57 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14660 189 / 8e-57 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14640 186 / 7e-56 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT5G38450 186 / 1e-55 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) AT2G46960 181 / 8e-55 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036820 [exp] 483 / 2e-171 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 372 / 6e-123 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10006245 [exp] 359 / 6e-118 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019186 [exp] 272 / 7e-93 AT2G46950 134 / 1e-36 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10026681 [exp] 251 / 1e-79 AT3G14620 322 / 4e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10036822 [exp] 249 / 5e-79 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10004633 [exp] 245 / 1e-78 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10002108 [exp] 237 / 2e-75 AT2G26710 353 / 1e-116 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019184 [exp] 234 / 4e-74 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139400 [exp] 262 / 5e-85 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 257 / 5e-83 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 255 / 3e-82 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 252 / 3e-81 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 251 / 7e-81 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 233 / 5e-74 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G099200 [exp] 209 / 2e-66 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G098800 [exp] 212 / 9e-66 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099400 [exp] 209 / 1e-64 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101401 [exp] 209 / 1e-64 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10036823 pacid=23171341 polypeptide=Lus10036823 locus=Lus10036823.g ID=Lus10036823.BGIv1.0 annot-version=v1.0 ATGAACATGGTCAGCAAAAGAAAAGAAGGGAATACCAGTAGTAGTTCTGCAACTGATTTCCTTGGAATGCTTATCAAGGCTCATACCGATCCGGACATGA ACGATAGCATAACAATGGATGATCTGATTGATGAATGCAAGACATTCTACGTCGCAGGCCACGAAACCACAACGAGCTCGCTGACCTGGACGGTACTTCT CTTAGCCATTCACTCTGAATGGCAAGAGAAAGCCAGGGAACAAGTGATTCAACTGTTTGGCAATAACACAACTCCAACTCCGGATGGAATTTCCAGATTG TCCATTCTGACAATGATCATTAATGAATCTCTGAGGCTATACCCTTCAGTGTTACACCTCTCGAGGAAAGTCGAACAAGACCAAGTACGATTGGGTGGAA AGCTAAGTCTTCCGAAAGGGACTGAAGTCTACATCCCGAATCTTGCAGTGCAGCATGCACATGAAATATGGGGGGAAGATGCTCAGCTCTTTAGACCTGA AAGATTTGCAGAATCAGGGGTAGTTAAAGCTGCTACATTTCTACCGTTCGGGTTGGGGCCTCGAAACTGTGTAGGTATGAACTTTGCTATCACGGAAGAG AAGATTGCACTGTCGATGATTTTGCAGCGTTACAGGTTTAGCCTATCGGACAAGTATGTGCACTCCCCGGCTCAGGTTTTGACTAGCTGCCCACAGCATG GTCTGCAAATTGTTCTTGAGAAACTTTCAAGGAAGGAATGA
AA sequence Show only first row Show all	>Lus10036823 pacid=23171341 polypeptide=Lus10036823 locus=Lus10036823.g ID=Lus10036823.BGIv1.0 annot-version=v1.0 MNMVSKRKEGNTSSSSATDFLGMLIKAHTDPDMNDSITMDDLIDECKTFYVAGHETTTSSLTWTVLLLAIHSEWQEKAREQVIQLFGNNTTPTPDGISRL SILTMIINESLRLYPSVLHLSRKVEQDQVRLGGKLSLPKGTEVYIPNLAVQHAHEIWGEDAQLFRPERFAESGVVKAATFLPFGLGPRNCVGMNFAITEE KIALSMILQRYRFSLSDKYVHSPAQVLTSCPQHGLQIVLEKLSRKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10036823 [exp]	0	1
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036820 [exp]	2.0	0.9783
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10000038 [exp]	3.7	0.9695
					Lus10002465 [exp]	4.5	0.9573
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10024078 [exp]	5.2	0.9667
AT2G40260	GARP		Homeodomain-like superfamily p...		Lus10007513 [exp]	6.3	0.9600
AT1G11050			Protein kinase superfamily pro...		Lus10028551 [exp]	6.9	0.9265
					Lus10008301 [exp]	8.4	0.9549
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036537 [exp]	8.5	0.9528
AT5G25140		CYP71B13	"cytochrome P450, family 71, s...		Lus10018263 [exp]	9.9	0.9465
AT2G40260	GARP		Homeodomain-like superfamily p...		Lus10040945 [exp]	11.0	0.9560

Compare expression of checked genes

Lus10036823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.