Lus10036830 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G03830 39 / 0.0002 RGF8 root meristem growth factor 8, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019193 59 / 7e-11 AT2G03810 50 / 1e-06 18S pre-ribosomal assembly protein gar2-related (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G138001 47 / 3e-07 AT2G03830 43 / 6e-06 root meristem growth factor 8, unknown protein
PFAM info
Representative CDS sequence
>Lus10036830 pacid=23171287 polypeptide=Lus10036830 locus=Lus10036830.g ID=Lus10036830.BGIv1.0 annot-version=v1.0
ATGGAGCTTAGTGTTGTAATGGTGAATGCTACTACTTGGTCTATCTTCCTCTTCTTGTCCATCTTCTTCTTTTTCTTCTCAATCCCACTGGCTTCTGCTC
ATCATGCCTTGGTTGTTAGTGGTCGCGAAACAGCTAAACCCTCAATGTTGTTGCCGCTTCCGAGGAAGCTCAAACTCCTCGAGGAAGTTGCATCCATTGA
AGTACATCAAAACAACAAGGGAGATCATCATCTCCATGACGGCAGCACGTACAAGGAAGAAGACGGTGCATCAACATCGACATCGTCAGGAAAATCATAC
AAGGAGAAGAAAGATGAAGATGGTGATGAAGAAGAAGGGATCAATACGGTGCAGTATTATACCACAATGGATTATTCCCACGTTAGGAAAAGGCGTCCAA
TCCATAACAAATCTTTGCCACGTGGTCCTTAA
AA sequence
>Lus10036830 pacid=23171287 polypeptide=Lus10036830 locus=Lus10036830.g ID=Lus10036830.BGIv1.0 annot-version=v1.0
MELSVVMVNATTWSIFLFLSIFFFFFSIPLASAHHALVVSGRETAKPSMLLPLPRKLKLLEEVASIEVHQNNKGDHHLHDGSTYKEEDGASTSTSSGKSY
KEKKDEDGDEEEGINTVQYYTTMDYSHVRKRRPIHNKSLPRGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G03830 RGF8 root meristem growth factor 8,... Lus10036830 0 1
AT1G31770 ABCG14 ATP-binding cassette G14, ATP-... Lus10037283 1.7 0.9480
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Lus10006199 1.7 0.9494
AT4G28360 Ribosomal protein L22p/L17e fa... Lus10006865 4.0 0.9480
AT1G77260 S-adenosyl-L-methionine-depend... Lus10000973 5.1 0.9198
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041975 5.5 0.9343
AT4G05390 ATRFNR1 root FNR 1 (.1.2) Lus10038538 8.9 0.9468
AT4G21110 G10 family protein (.1) Lus10035562 9.2 0.8916
AT1G31910 GHMP kinase family protein (.1... Lus10012122 11.0 0.9301
AT1G43800 Plant stearoyl-acyl-carrier-pr... Lus10028627 11.5 0.9227
AT5G19730 Pectin lyase-like superfamily ... Lus10012942 11.8 0.9283

Lus10036830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.