Lus10036841 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13620 41 / 5e-05 RGF2 root meristem growth factor 2, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036838 239 / 4e-82 ND 42 / 2e-05
Lus10019202 161 / 2e-51 AT1G13620 44 / 4e-06 root meristem growth factor 2, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G112400 39 / 0.0005 AT2G04025 42 / 1e-05 root meristem growth factor 3, unknown protein
PFAM info
Representative CDS sequence
>Lus10036841 pacid=23171256 polypeptide=Lus10036841 locus=Lus10036841.g ID=Lus10036841.BGIv1.0 annot-version=v1.0
ATGAAGATTTCCTCCTCGTCGTTGTCTTTTACGGCTAATTTATTGATCGTTGTTGTCGTCACCATTGTCGCTGTCACTCTGTTCTCTCGTGCTCCGACTT
CCAGTTTTACTACCGTCGTTGTTGCTGACGAGATTGTGCCTTCTCATCCCATCAAGGGACCATCAAGGAATGCCACTAATGTCAAAGAGTCGAACATCGA
GCCTGCGACAAAAACTGTCAAAGGGAGTGATAACAATCGAAAGGGAGATGGGAAGAGGAATAAGGAGGCTAAGCATGTTGTGAACAAAGTCGGAGGAAGG
AAATCGATGAAATTTGGTTCTGCTGTTGTTGCTGATGAAACTTCTACTGATTCCTCGTCGTTTGAGACCTCGAAGCATAACTATGCAAATGATGCTAGGG
CTCTTGTTGCTTTCACTTCTGATTATCGTTCTCCAAGACATCACCCTCCGAAGAACAACTAA
AA sequence
>Lus10036841 pacid=23171256 polypeptide=Lus10036841 locus=Lus10036841.g ID=Lus10036841.BGIv1.0 annot-version=v1.0
MKISSSSLSFTANLLIVVVVTIVAVTLFSRAPTSSFTTVVVADEIVPSHPIKGPSRNATNVKESNIEPATKTVKGSDNNRKGDGKRNKEAKHVVNKVGGR
KSMKFGSAVVADETSTDSSSFETSKHNYANDARALVAFTSDYRSPRHHPPKNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10036841 0 1
Lus10036838 1.0 1.0000
AT2G21100 Disease resistance-responsive ... Lus10034480 6.3 0.7359
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10011999 6.9 0.8573
AT1G65450 HXXXD-type acyl-transferase fa... Lus10029920 10.8 0.7914
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10034348 12.5 0.7914
AT3G10490 NAC ANAC051, ANAC05... Arabidopsis NAC domain contain... Lus10014342 12.8 0.5370
AT3G10660 ATCPK2, CPK2 calmodulin-domain protein kina... Lus10016190 13.9 0.7758
AT5G37060 ATCHX24 cation/H+ exchanger 24, ARABID... Lus10031852 14.1 0.7803
Lus10042238 15.8 0.7671
Lus10011637 16.5 0.7721

Lus10036841 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.