Lus10036855 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70600 255 / 6e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G23290 252 / 1e-87 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 125 / 3e-38 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006207 295 / 1e-104 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10004617 285 / 2e-100 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10016336 282 / 2e-99 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10039528 280 / 2e-98 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10026698 280 / 2e-98 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10024161 278 / 1e-97 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 273 / 6e-96 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 270 / 6e-95 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 270 / 1e-94 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 270 / 1e-94 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10036855 pacid=23171133 polypeptide=Lus10036855 locus=Lus10036855.g ID=Lus10036855.BGIv1.0 annot-version=v1.0
ATGGCGACCAGATTCAAGAAGAACAGGAAGAAGAGAGGCCACGTCAGCGCCGGACATGGACGTGTCGGCAAGCATAGGAAGCATCCCGGAGGTCGCGGTA
ACGCCGGAGGTATGCACCACCACCGGATCTTGTTCGACAAGTACCATCCAGGTTACTTCGGTAAGGTCGGTATGAGGTACTTCCACAAGCTGAAGAACAG
GTTCTTCTGCCCGATCGTCAACATCGACAAGCTGTGGTCGATGGTGCCTCAGGAGGTGAAGGACAAGGCCGCGAAGGACGGCAGCGTTGCTCCGATGATC
GACGTGACTCAGTTCGGTTACTTCAAGGTGCTTGGGAAGGGAGTGTTGCCGGATAATCAGGCGATCGTGGTGAAGGCCAAGCTCGTGTCCAAGTGTGCCG
AGAAGAAGATTAAGGAAGCTGGAGGAGCTGTTGTACTCACTGCCTGA
AA sequence
>Lus10036855 pacid=23171133 polypeptide=Lus10036855 locus=Lus10036855.g ID=Lus10036855.BGIv1.0 annot-version=v1.0
MATRFKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSMVPQEVKDKAAKDGSVAPMI
DVTQFGYFKVLGKGVLPDNQAIVVKAKLVSKCAEKKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10036855 0 1
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10026698 1.0 0.9638
AT5G60670 Ribosomal protein L11 family p... Lus10019935 2.0 0.9520
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10011005 3.2 0.9129
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10024161 3.2 0.8844
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 3.5 0.9235
AT1G07930 GTP binding Elongation factor ... Lus10015070 4.0 0.9173
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10018393 4.9 0.8899
AT5G60670 Ribosomal protein L11 family p... Lus10026506 4.9 0.9031
AT1G77405 Pentatricopeptide repeat (PPR)... Lus10042736 8.0 0.8652
AT3G11250 Ribosomal protein L10 family p... Lus10014841 13.0 0.8994

Lus10036855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.