Lus10036862 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 110 / 5e-31 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT3G48240 101 / 3e-27 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 92 / 1e-22 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G57610 93 / 3e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT5G63130 86 / 3e-21 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G79570 87 / 3e-20 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 87 / 6e-20 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G01190 86 / 1e-19 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G16270 85 / 2e-19 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006214 312 / 3e-110 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10026700 130 / 3e-38 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10043341 109 / 5e-30 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019490 108 / 1e-29 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10035641 92 / 5e-23 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 93 / 4e-22 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10006977 93 / 4e-22 AT5G57610 1048 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10001314 92 / 6e-22 AT5G57610 393 / 1e-125 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10002588 92 / 9e-22 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G046400 146 / 4e-44 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.008G186500 142 / 1e-42 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.012G085000 102 / 2e-27 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.015G083400 100 / 1e-26 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G032200 89 / 4e-21 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G170700 89 / 7e-21 AT5G57610 1087 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.003G006200 87 / 8e-21 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G224500 87 / 2e-20 AT5G49920 185 / 3e-56 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 87 / 2e-20 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G190200 86 / 8e-20 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10036862 pacid=23171103 polypeptide=Lus10036862 locus=Lus10036862.g ID=Lus10036862.BGIv1.0 annot-version=v1.0
ATGGCAACTACTACTTCGCCGGACTCAGCCACCATCAAGTTCCAGTGCAGCCACGGCGGCAAGCTCGTCCCCCGCCCCCTCGACGGCAAGCTCCGCTACC
ACGGTGGTGAAACCCGAGTCCTCACTGTCAGCCGATCGATTTCCTACTCCGAATTATTAATCAAGTTAGGACGGGTGAACTATGAGGACAGTAAGGTGAT
GCGTTTGCGTTGTCAATTGCCGGAGGTTGATCTTGACGACGCACTGGTGAACATAGTCTCCGACGAGGATTTGACTAGTCTCATTGAGGAATACGATCGA
GTTGCTACTCCTGCAACCTCGTCTTTGAAAATTAGGGCCTTCCTTTCGTCCCCGACAAAAATATCTGCCGATGATCTATCATCTACTTCATCTTCCTCAT
CCTCCTCGTCGTCCTCCTCGTCACATACTTTTGATGCAAGGTTATGTTCCCCGAAATGTTTCAACCGTCGAGTTTCTAAGACGACAATAGTGGCTTCGCC
GGCGAGGAAGGTCCCCCGATATGGTTACGTCTACGATAGAGATCATTGGCAATGA
AA sequence
>Lus10036862 pacid=23171103 polypeptide=Lus10036862 locus=Lus10036862.g ID=Lus10036862.BGIv1.0 annot-version=v1.0
MATTTSPDSATIKFQCSHGGKLVPRPLDGKLRYHGGETRVLTVSRSISYSELLIKLGRVNYEDSKVMRLRCQLPEVDLDDALVNIVSDEDLTSLIEEYDR
VATPATSSLKIRAFLSSPTKISADDLSSTSSSSSSSSSSSSHTFDARLCSPKCFNRRVSKTTIVASPARKVPRYGYVYDRDHWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10036862 0 1
AT5G60850 DOF OBP4, AtDof5. 4 OBF binding protein 4 (.1) Lus10017882 1.4 0.9019
AT3G48360 ATBT2, BT2 BTB and TAZ domain protein 2 (... Lus10018087 2.8 0.8749
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10006214 3.3 0.9240
AT1G70820 phosphoglucomutase, putative /... Lus10020414 3.5 0.8826
AT1G19670 CORI1, ATHCOR1,... CORONATINE-INDUCED PROTEIN 1, ... Lus10004076 5.2 0.8641
AT1G70820 phosphoglucomutase, putative /... Lus10015835 6.3 0.8880
AT5G24470 APRR5 pseudo-response regulator 5 (.... Lus10023230 6.6 0.8466
AT4G37680 HHP4 heptahelical protein 4 (.1.2) Lus10010605 7.5 0.8394
AT5G28237 Pyridoxal-5'-phosphate-depende... Lus10007651 11.5 0.8264
AT2G23110 Late embryogenesis abundant pr... Lus10042745 11.8 0.8797

Lus10036862 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.