Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006216 [exp] 125 / 9e-40 ND / Lus10006665 [exp] 72 / 1e-16 AT1G49320 177 / 3e-53 unknown seed protein like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G185900 [exp] 54 / 4e-11 ND / Potri.010G047000 [exp] 36 / 0.0003 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036864 pacid=23171301 polypeptide=Lus10036864 locus=Lus10036864.g ID=Lus10036864.BGIv1.0 annot-version=v1.0 ATGTCGTCATCATCATCCAGAATTAATAACCTTTGTGCAGGTTACGATTATTATCCTTCGAAATGCGACGGGGTTAAGAGGTTCGAGAGATCTCCTCCTT CACCAATCTGTGTCAAGTTTGGCAGTCGGAAAATTTGCAGCGACAGTGTCGACACTGTAGCTGAAGAGTTCATCAGGCTGGAGCACAAGAAGTTCGAAGC TAGCAAGACCATGTCCATCAACCATGGCTAA
AA sequence Show only first row Show all	>Lus10036864 pacid=23171301 polypeptide=Lus10036864 locus=Lus10036864.g ID=Lus10036864.BGIv1.0 annot-version=v1.0 MSSSSSRINNLCAGYDYYPSKCDGVKRFERSPPSPICVKFGSRKICSDSVDTVAEEFIRLEHKKFEASKTMSINHG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036864 [exp]	0	1
AT1G66400		CML23	calmodulin like 23 (.1)		Lus10021732 [exp]	1.0	0.8810
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	4.9	0.8745
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10038141 [exp]	5.3	0.8396
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031237 [exp]	6.7	0.8506
AT2G38870			Serine protease inhibitor, pot...		Lus10018784 [exp]	12.8	0.8047
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10019801 [exp]	13.2	0.8291
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10030446 [exp]	25.3	0.8291
AT3G19920			unknown protein		Lus10017384 [exp]	28.5	0.7661
AT1G33030			O-methyltransferase family pro...		Lus10009442 [exp]	36.3	0.8302
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Lus10017022 [exp]	41.1	0.7125

Compare expression of checked genes

Lus10036864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.