Gene [FLAX] | FIBexDB

Lus10036867 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT1G66310	41 / 0.0002			F-box/RNI-like/FBD-like domains-containing protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10042330 [exp]	105 / 3e-30	ND	/
Lus10024696 [exp]	102 / 6e-26	AT5G22720	75 / 1e-14	F-box/RNI-like superfamily protein (.1.2)
Lus10024694 [exp]	96 / 8e-25	ND	/
Lus10007058 [exp]	96 / 8e-24	AT5G56810	77 / 2e-15	F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10020748 [exp]	94 / 3e-23	AT3G28410	73 / 4e-14	F-box/RNI-like superfamily protein (.1)
Lus10029357 [exp]	94 / 4e-23	AT3G28410	79 / 1e-15	F-box/RNI-like superfamily protein (.1)
Lus10042477 [exp]	94 / 5e-23	AT1G16930	77 / 2e-15	F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10002239 [exp]	91 / 7e-22	AT1G69630	91 / 5e-20	F-box/RNI-like superfamily protein (.1)
Lus10026190 [exp]	90 / 1e-21	AT1G16930	80 / 3e-16	F-box/RNI-like/FBD-like domains-containing protein (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.015G002100 [exp]	63 / 6e-12	AT4G03220	103 / 5e-24	Protein with RNI-like/FBD-like domains (.1)
Potri.001G337200 [exp]	54 / 6e-09	AT5G22660	86 / 6e-19	FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Potri.015G011200 [exp]	49 / 4e-07	AT4G03220	90 / 1e-19	Protein with RNI-like/FBD-like domains (.1)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10036867 pacid=23171092 polypeptide=Lus10036867 locus=Lus10036867.g ID=Lus10036867.BGIv1.0 annot-version=v1.0

ATGTCTCGAGGATTTGACCCTGAACGGTGCAAGGACCGCAATGATCGAGCTGAGACATTCAAGATTTCTGGACAACAGTTGCGTACTTTGAACGTCTCGT

ACAACCAATTCGCCACAGTTGCAATAAATGCACCAAATCTCAAGTCTTTCACTTTCTTTAACGATGATGACTTCATTCATTTCACAAAGCTAGTCCTTCC

CTCCCTTGTTCATGCTGATATCAGGATCAGCAACCGTAATTGTCCCGCTAAAAAGTACATTGACTATGTCGACGATTTTATCACATTCTTCACCGGGCTG

GGTAATGTAACGTCTCTTGCCTTGCGTCAATCTACCCTCGAGATACTGCATCACTTGTGCAAATTTCTGGAAGAGCAACCCTCCCCATTTACAAGGCTGG

AGACTCTGACTTTGGAACCTTACGACGATCATCGCAATCGTGAAGTGGTCCACTACTTCACCAAAGGCTCGAATATGAATGGGAAAGTTAAGTTTGTTTG

AA sequence

Show only first row Show all

>Lus10036867 pacid=23171092 polypeptide=Lus10036867 locus=Lus10036867.g ID=Lus10036867.BGIv1.0 annot-version=v1.0

MSRGFDPERCKDRNDRAETFKISGQQLRTLNVSYNQFATVAINAPNLKSFTFFNDDDFIHFTKLVLPSLVHADIRISNRNCPAKKYIDYVDDFITFFTGL

GNVTSLALRQSTLEILHHLCKFLEEQPSPFTRLETLTLEPYDDHRNREVVHYFTKGSNMNGKVKFV

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66310			F-box/RNI-like/FBD-like domain...		Lus10036867 [exp]	0	1

Lus10036867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.