Lus10036869 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48320 110 / 4e-32 Thioesterase superfamily protein (.1)
AT5G48950 85 / 3e-22 Thioesterase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006220 145 / 7e-46 AT1G48320 218 / 5e-74 Thioesterase superfamily protein (.1)
Lus10011142 100 / 2e-28 AT1G48320 203 / 4e-68 Thioesterase superfamily protein (.1)
Lus10043043 72 / 5e-17 AT1G48320 151 / 4e-47 Thioesterase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G003800 112 / 5e-33 AT1G48320 170 / 1e-54 Thioesterase superfamily protein (.1)
Potri.010G003600 103 / 2e-29 AT1G48320 197 / 1e-65 Thioesterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0050 HotDog PF03061 4HBT Thioesterase superfamily
Representative CDS sequence
>Lus10036869 pacid=23171083 polypeptide=Lus10036869 locus=Lus10036869.g ID=Lus10036869.BGIv1.0 annot-version=v1.0
ATGGGAGCACATATGGCATCAGGTTACAAAAGGGTCACTGGCATTCCCCTCAGCATTAGTCATTTGAAGAAGGCTAACCTTGGGGACCTTGTTCTTGCCG
AAGCCACCCCCATCACTGTTGGCAAGACCATTCAGGTGTGGGAGGTGCAAATCTGGAAAGTTTATCCATCAAGCACAGACAGCAGCAGCAAGTCCTCGAT
TTCATCATCTGGAGTCACTCGCCTAAGCAACATGTCGGTGCCTGAGCACGCCAAAGATGCTGCCGGAAATCTCAAGAGATACGCAAAATTGTGA
AA sequence
>Lus10036869 pacid=23171083 polypeptide=Lus10036869 locus=Lus10036869.g ID=Lus10036869.BGIv1.0 annot-version=v1.0
MGAHMASGYKRVTGIPLSISHLKKANLGDLVLAEATPITVGKTIQVWEVQIWKVYPSSTDSSSKSSISSSGVTRLSNMSVPEHAKDAAGNLKRYAKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48320 Thioesterase superfamily prote... Lus10036869 0 1
AT1G53200 unknown protein Lus10005971 1.4 0.9130
AT1G31660 unknown protein Lus10027134 2.2 0.8815
AT3G14460 LRR and NB-ARC domains-contain... Lus10039577 2.4 0.8966
Lus10015488 4.2 0.9039
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10020736 7.2 0.8909
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10022572 8.1 0.8802
Lus10018970 9.5 0.8681
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10031424 9.9 0.8722
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025413 10.0 0.8729
Lus10031019 10.5 0.8194

Lus10036869 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.