Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24540 103 / 3e-27 CYP86C1 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) AT3G26125 95 / 3e-24 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1) AT1G13140 93 / 2e-23 CYP86C3 "cytochrome P450, family 86, subfamily C, polypeptide 3", cytochrome P450, family 86, subfamily C, polypeptide 3 (.1.2) AT1G13150 92 / 4e-23 CYP86C4 "cytochrome P450, family 86, subfamily C, polypeptide 4", cytochrome P450, family 86, subfamily C, polypeptide 4 (.1) AT5G23190 89 / 3e-22 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT5G58860 84 / 3e-20 CYP86A1 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) AT1G01600 83 / 8e-20 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1) AT5G08250 80 / 7e-19 Cytochrome P450 superfamily protein (.1) AT4G00360 79 / 2e-18 ATT1, CYP86A2 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) AT2G45970 78 / 4e-18 CYP86A8, LCR LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006232 [exp] 133 / 4e-38 AT1G24540 524 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Lus10017394 [exp] 95 / 5e-24 AT5G23190 739 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10010193 [exp] 94 / 8e-24 AT5G23190 741 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10040986 [exp] 93 / 2e-23 AT5G23190 751 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10014768 [exp] 80 / 1e-18 AT4G00360 756 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10018831 [exp] 77 / 2e-18 AT4G00360 403 / 8e-139 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10018217 [exp] 77 / 9e-18 AT5G58860 802 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Lus10040687 [exp] 77 / 1e-17 AT5G58860 803 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Lus10024644 [exp] 74 / 1e-16 AT1G63710 562 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G183300 [exp] 107 / 2e-28 AT1G24540 682 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.010G050100 [exp] 102 / 5e-27 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.005G092200 [exp] 92 / 2e-23 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.007G072100 [exp] 91 / 6e-23 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.014G085800 [exp] 81 / 3e-19 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.001G249700 [exp] 81 / 3e-19 AT5G58860 790 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.009G043700 [exp] 79 / 1e-18 AT5G58860 827 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.001G397900 [exp] 79 / 2e-18 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.003G129100 [exp] 77 / 1e-17 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.007G080300 [exp] 74 / 1e-16 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10036880 pacid=23170981 polypeptide=Lus10036880 locus=Lus10036880.g ID=Lus10036880.BGIv1.0 annot-version=v1.0 ATGGAGTCGGTGTGGGGCACGACCTTCCCGTCTCCATCAATCCACCTCAAGTATGCTGTGTTCAATGGAGGGCCAAGGCTCTGTTTGGGGAAGAGGTTTG CTTACACACAGATGAAAATGGTGGCTGCTTCCATCTTGCTGAGGTTTCGAGTCGAGGTTGTCAAGGGTCATTCTGTTGTTCCTAAAGTTACCACAACTCT TTACATGAAGGATGGATTGTTGGTGAAACTTAAGCGTAGGGCAAACCTGCTAGAGGTTTACGTAGAGGTGGGGATTAGTTCAGTTATGGTCAAGTAA
AA sequence Show only first row Show all	>Lus10036880 pacid=23170981 polypeptide=Lus10036880 locus=Lus10036880.g ID=Lus10036880.BGIv1.0 annot-version=v1.0 MESVWGTTFPSPSIHLKYAVFNGGPRLCLGKRFAYTQMKMVAASILLRFRVEVVKGHSVVPKVTTTLYMKDGLLVKLKRRANLLEVYVEVGISSVMVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10036880 [exp]	0	1
AT1G65440		GTB1	global transcription factor gr...		Lus10034231 [exp]	1.4	0.8191
AT3G22490			Seed maturation protein (.1)		Lus10015948 [exp]	1.7	0.8364
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10039513 [exp]	4.0	0.7975
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10021345 [exp]	4.5	0.7736
AT3G19090			RNA-binding protein (.1)		Lus10027925 [exp]	6.9	0.8010
					Lus10039943 [exp]	10.1	0.7679
AT1G22900			Disease resistance-responsive ...		Lus10021083 [exp]	10.5	0.6893
AT2G14540		ATSRP2	serpin 2 (.1)		Lus10009905 [exp]	11.4	0.7251
AT5G05340			Peroxidase superfamily protein...		Lus10009936 [exp]	14.1	0.7431
AT1G68630			PLAC8 family protein (.1)		Lus10008890 [exp]	14.1	0.7355

Compare expression of checked genes

Lus10036880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.