Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13870 87 / 1e-22 DRL1, AtKTI12 DEFORMED ROOTS AND LEAVES 1, calmodulin binding;purine nucleotide binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037100 [exp] 135 / 7e-41 AT1G13870 435 / 5e-155 DEFORMED ROOTS AND LEAVES 1, calmodulin binding;purine nucleotide binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G094600 [exp] 118 / 2e-34 AT1G13870 451 / 2e-161 DEFORMED ROOTS AND LEAVES 1, calmodulin binding;purine nucleotide binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF08433 [flax] [poplar] KTI12 Chromatin associated protein KTI12
Representative CDS sequence Show only first row Show all	>Lus10036884 pacid=23171298 polypeptide=Lus10036884 locus=Lus10036884.g ID=Lus10036884.BGIv1.0 annot-version=v1.0 ATGAATGGTATCTCTATTGGACCGGACTTGCCAACTCTTAACATTTCGAAATCGGTTGGGTTGCCAGAGCTTCGGAGGCTGAGGCGAACGTTTATGAAGT TAACCGGTCAGACCAGCTTGAGTGGACGCCCTCCTCCATCGGATGCTGAGAGTGCAAAGAGGATGTTCGTGGATTACTTGAACAGGGAGCTTGATACTGC TTGA
AA sequence Show only first row Show all	>Lus10036884 pacid=23171298 polypeptide=Lus10036884 locus=Lus10036884.g ID=Lus10036884.BGIv1.0 annot-version=v1.0 MNGISIGPDLPTLNISKSVGLPELRRLRRTFMKLTGQTSLSGRPPPSDAESAKRMFVDYLNRELDTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13870		DRL1, AtKTI12	DEFORMED ROOTS AND LEAVES 1, c...		Lus10036884 [exp]	0	1
AT5G23395		MIA40	mitochondrial intermembrane sp...		Lus10001795 [exp]	6.9	0.7925
AT2G39960			Microsomal signal peptidase 25...		Lus10014838 [exp]	7.7	0.7967
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	8.8	0.8264
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10001201 [exp]	14.3	0.8081
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10036203 [exp]	17.6	0.8032
AT3G26085			CAAX amino terminal protease f...		Lus10006251 [exp]	19.4	0.8016
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Lus10031408 [exp]	20.9	0.8216
AT1G11760		MED32	unknown protein		Lus10034758 [exp]	21.6	0.7974
AT1G47820			unknown protein		Lus10035088 [exp]	24.5	0.7690
AT1G67620			Lojap-related protein (.1)		Lus10015822 [exp]	27.2	0.7925

Compare expression of checked genes

Lus10036884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.