Lus10036905 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22660 54 / 1e-08 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
AT5G22700 52 / 6e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT1G22000 51 / 7e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT5G53840 50 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT2G04230 50 / 1e-07 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT1G66290 50 / 2e-07 F-box/RNI-like superfamily protein (.1)
AT2G39415 47 / 2e-07 F-box family protein (.1)
AT3G49030 49 / 4e-07 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
AT1G60400 49 / 4e-07 F-box/RNI-like superfamily protein (.1)
AT1G13780 49 / 4e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003696 119 / 1e-33 AT3G51530 52 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10029003 120 / 4e-32 AT3G49030 57 / 3e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Lus10029083 111 / 7e-29 AT1G67390 54 / 6e-08 F-box family protein (.1)
Lus10037289 110 / 2e-28 AT5G02920 61 / 4e-10 F-box/RNI-like superfamily protein (.1)
Lus10034290 107 / 1e-27 AT5G02910 53 / 2e-07 F-box/RNI-like superfamily protein (.1.2)
Lus10037261 94 / 4e-24 AT5G02920 65 / 1e-12 F-box/RNI-like superfamily protein (.1)
Lus10028939 91 / 6e-22 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1)
Lus10019167 67 / 2e-14 ND 45 / 3e-06
Lus10027471 68 / 9e-14 AT5G22730 55 / 2e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G146500 53 / 2e-08 AT5G02920 64 / 2e-11 F-box/RNI-like superfamily protein (.1)
Potri.013G146800 52 / 6e-08 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1)
Potri.011G098700 50 / 2e-07 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Potri.001G322900 47 / 2e-06 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
Potri.015G011200 46 / 3e-06 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.017G146400 46 / 4e-06 AT3G28410 79 / 2e-15 F-box/RNI-like superfamily protein (.1)
Potri.014G039700 45 / 1e-05 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1)
Potri.011G024200 45 / 1e-05 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.015G002001 44 / 2e-05 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.011G104100 44 / 2e-05 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10036905 pacid=23171122 polypeptide=Lus10036905 locus=Lus10036905.g ID=Lus10036905.BGIv1.0 annot-version=v1.0
ATGTCACTGGGCGCCGTCGACCGAATCTCGGAACTACCGGAAGAGATCATCAATCCCATCCTTCAAAACTTACCCTCTCATGAGGAAGCAGCGAGAACCA
GCATCTTGTCAAGAAGATGGCTCCAGCTATGGCTCTCTTACCCCGTCATGGAGTTTGACAATGGAGGGAGCGTAAACTTTGAGAGACTTGCCTCCGCCAC
TTCCAAGAGACTGCAGCTAGCAGCATCGCCGTTACTTTTGGACACATTTACCATAACACTGGGGCTCCCGAGATACTTAATACTCAGTCGTCAGGAGAAA
CTCCAACAACAGTTGCGATATGGCAAAAACCTTGGCGGCTTTCTTGGCCCGCTGCTGTCATCGGCCAGCAGCCGATCTCCGCTTAAGGTTGTGGTTAAAA
ATTATTTCGATTTCGCTGGTTCCCTTAATTCAGGATTCCTCGTGAATTGTGGTCGAGGATTGTTCTTGAATTGCGGCCTCACCAAATTCCTCTACCTAAG
AGGTTGCGACCTTGTGCAGTTCTGA
AA sequence
>Lus10036905 pacid=23171122 polypeptide=Lus10036905 locus=Lus10036905.g ID=Lus10036905.BGIv1.0 annot-version=v1.0
MSLGAVDRISELPEEIINPILQNLPSHEEAARTSILSRRWLQLWLSYPVMEFDNGGSVNFERLASATSKRLQLAASPLLLDTFTITLGLPRYLILSRQEK
LQQQLRYGKNLGGFLGPLLSSASSRSPLKVVVKNYFDFAGSLNSGFLVNCGRGLFLNCGLTKFLYLRGCDLVQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G22660 FBD, F-box, Skp2-like and Leuc... Lus10036905 0 1
AT4G32010 B3 HSL1, HSI2-L1, ... VP1/ABI3-LIKE 2, HSI2-like 1 (... Lus10022741 5.2 0.7489
AT5G61120 unknown protein Lus10030998 8.1 0.7685
AT2G19930 RNA-dependent RNA polymerase f... Lus10012965 9.2 0.8139
AT5G43900 XI-6, XI-2, ATM... MYOSIN XI-6, MYOSIN X1 2, ARAB... Lus10043153 14.3 0.7731
AT4G30935 WRKY ATWRKY32, WRKY3... WRKY DNA-binding protein 32 (.... Lus10036268 15.4 0.7783
AT5G05940 ATROPGEF5, ROPG... ROP guanine nucleotide exchang... Lus10009874 17.5 0.8052
AT1G10380 Putative membrane lipoprotein ... Lus10036906 34.6 0.7380
AT5G62090 SLK2 SEUSS-like 2 (.1.2) Lus10038880 45.0 0.7470
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10042646 50.8 0.7440
AT2G32010 CVL1 CVP2 like 1 (.1.2) Lus10039352 52.2 0.7428

Lus10036905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.