Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69290 100 / 1e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G68980 72 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G03100 36 / 0.0003 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037077 [exp] 115 / 3e-32 AT1G69290 827 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037275 [exp] 40 / 2e-05 AT4G17616 560 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G095800 [exp] 106 / 6e-29 AT1G69290 860 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G212400 [exp] 40 / 2e-05 AT1G03100 1044 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G084400 [exp] 37 / 0.0002 AT4G17616 676 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036907 pacid=23171328 polypeptide=Lus10036907 locus=Lus10036907.g ID=Lus10036907.BGIv1.0 annot-version=v1.0 ATGCAAGTTGTGGAGAAATCCCAAGAGATGAAGATCTTTGTGGATAAGTGGCGATACAAACAAGCGTTTATGGAGAAGCATAAGAAGCTAAAGGTGTCGA AATTGAGAAGGAACTTCCGGAAAATGGAAGCGCTTATCGCATTCAAGAACTGGGCTGGACTAAACGCATGA
AA sequence Show only first row Show all	>Lus10036907 pacid=23171328 polypeptide=Lus10036907 locus=Lus10036907.g ID=Lus10036907.BGIv1.0 annot-version=v1.0 MQVVEKSQEMKIFVDKWRYKQAFMEKHKKLKVSKLRRNFRKMEALIAFKNWAGLNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69290			Pentatricopeptide repeat (PPR)...		Lus10036907 [exp]	0	1
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030865 [exp]	19.9	0.7559
AT3G19700		IKU2	HAIKU2, Leucine-rich repeat pr...		Lus10012461 [exp]	27.9	0.7386
AT3G24060			Plant self-incompatibility pro...		Lus10011754 [exp]	32.6	0.7259
AT4G12750			Homeodomain-like transcription...		Lus10016078 [exp]	34.6	0.7529
AT5G11630			unknown protein		Lus10011623 [exp]	43.5	0.6659
AT5G04670			Enhancer of polycomb-like tran...		Lus10008985 [exp]	56.6	0.7420
AT5G11030		ALF4	aberrant lateral root formatio...		Lus10006197 [exp]	61.1	0.7428
AT2G02750			Pentatricopeptide repeat (PPR)...		Lus10000073 [exp]	78.5	0.7369
AT3G17920			Outer arm dynein light chain 1...		Lus10041989 [exp]	89.8	0.7270
					Lus10020187 [exp]	95.2	0.7224

Compare expression of checked genes

Lus10036907 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.