Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26355 109 / 3e-32 SP1L1 SPIRAL1-like1 (.1) AT1G69230 99 / 3e-28 SP1L2 SPIRAL1-like2 (.1.2) AT2G03680 84 / 4e-22 SKU6, SPR1 spiral1 (.1.2) AT3G02180 78 / 1e-19 SP1L3 SPIRAL1-like3 (.1.2.3) AT5G15600 78 / 1e-19 SP1L4 SPIRAL1-like4 (.1) AT4G23496 70 / 8e-17 SP1L5 SPIRAL1-like5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000046 [exp] 183 / 3e-61 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10037069 [exp] 172 / 4e-57 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10026672 [exp] 113 / 9e-34 AT1G26355 149 / 4e-48 SPIRAL1-like1 (.1) Lus10026670 [exp] 113 / 1e-33 AT1G26355 150 / 1e-48 SPIRAL1-like1 (.1) Lus10004642 [exp] 110 / 2e-32 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10034675 [exp] 91 / 2e-24 AT1G26355 127 / 5e-39 SPIRAL1-like1 (.1) Lus10032988 [exp] 76 / 8e-19 AT1G69230 99 / 8e-28 SPIRAL1-like2 (.1.2) Lus10024667 [exp] 67 / 4e-16 AT4G23496 74 / 2e-19 SPIRAL1-like5 (.1) Lus10032297 [exp] 68 / 5e-16 AT1G69230 98 / 7e-28 SPIRAL1-like2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G097000 [exp] 107 / 2e-31 AT1G26355 127 / 2e-39 SPIRAL1-like1 (.1) Potri.010G157600 [exp] 103 / 6e-30 AT1G26355 120 / 1e-36 SPIRAL1-like1 (.1) Potri.017G095200 [exp] 95 / 2e-26 AT1G69230 94 / 2e-26 SPIRAL1-like2 (.1.2) Potri.015G059100 [exp] 86 / 5e-23 AT1G26355 98 / 1e-27 SPIRAL1-like1 (.1) Potri.001G100100 [exp] 73 / 6e-18 AT4G23496 81 / 2e-21 SPIRAL1-like5 (.1) Potri.003G131600 [exp] 71 / 3e-17 AT4G23496 81 / 4e-21 SPIRAL1-like5 (.1) Potri.T124504 [exp] 56 / 4e-10 AT1G19270 182 / 3e-53 DA1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036916 pacid=23170982 polypeptide=Lus10036916 locus=Lus10036916.g ID=Lus10036916.BGIv1.0 annot-version=v1.0 ATGGGCCGTGGAGTTAGCAGCGGCGGAGGGCAGAGTTCGTTAGGATATCTATTCGGGAGTGGTGAAGCACCCAAACCTGCTAAACCTAGTGTCGAGACAG CTGCCCCTGTTGAGGCCGAGACTATAAATGTTAGGCCGATCTCGAAACCTGCTCCTCCAGTAGATGTCGCAAAGCAGATTCCCGCCGGCATTAACAGTAC TTCCTCGAACAACTACATGCGCGCTGATGGCCAGAACGCCGGCAACTTCCTCACTGACCGACCTTCAACGAAAGTTCATGCTGCACCAGGAGGCGGATCT TCTCTGGGTTACCTGTTTGGTAACGGTGGTAGTAAATGA
AA sequence Show only first row Show all	>Lus10036916 pacid=23170982 polypeptide=Lus10036916 locus=Lus10036916.g ID=Lus10036916.BGIv1.0 annot-version=v1.0 MGRGVSSGGGQSSLGYLFGSGEAPKPAKPSVETAAPVEAETINVRPISKPAPPVDVAKQIPAGINSTSSNNYMRADGQNAGNFLTDRPSTKVHAAPGGGS SLGYLFGNGGSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10036916 [exp]	0	1
AT4G32530			ATPase, F0/V0 complex, subunit...		Lus10000347 [exp]	2.0	0.8240
AT1G01540			Protein kinase superfamily pro...		Lus10007919 [exp]	3.0	0.8367
AT5G16540	C3HZnF	ZFN3	zinc finger nuclease 3 (.1.2.3...		Lus10031527 [exp]	3.7	0.7743
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Lus10001986 [exp]	3.9	0.7920
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10042136 [exp]	4.5	0.7466
AT5G64020		TBL14	TRICHOME BIREFRINGENCE-LIKE 14...		Lus10037877 [exp]	11.8	0.8154
AT5G53750			CBS domain-containing protein ...		Lus10029665 [exp]	11.9	0.8217
AT5G10550		GTE2	global transcription factor gr...		Lus10020471 [exp]	14.1	0.7710
AT5G51010			Rubredoxin-like superfamily pr...		Lus10022430 [exp]	20.8	0.7504
AT1G64980			Nucleotide-diphospho-sugar tra...		Lus10005005 [exp]	21.4	0.7667

Compare expression of checked genes

Lus10036916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.