Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60980 153 / 3e-41 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G25150 144 / 8e-38 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G13730 141 / 6e-37 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT2G03640 137 / 7e-36 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain AT1G69250 126 / 7e-32 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G48650 112 / 7e-27 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT3G07250 85 / 3e-17 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1) AT3G55540 79 / 9e-16 nuclear transport factor 2 (NTF2) family protein (.1) AT5G43960 77 / 6e-15 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G27970 54 / 1e-08 NTF2B nuclear transport factor 2B (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037066 [exp] 644 / 0 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10026668 [exp] 392 / 2e-132 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10004644 [exp] 384 / 2e-129 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10022765 [exp] 154 / 2e-41 AT3G25150 408 / 1e-138 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10003144 [exp] 150 / 6e-40 AT3G25150 385 / 2e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10025906 [exp] 151 / 2e-39 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10014469 [exp] 120 / 2e-29 AT5G43960 156 / 4e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10022873 [exp] 103 / 1e-23 AT5G43960 377 / 1e-127 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10023722 [exp] 101 / 9e-23 AT5G43960 266 / 2e-83 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G096700 [exp] 283 / 2e-90 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.017G094600 [exp] 167 / 2e-46 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 166 / 1e-45 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G157800 [exp] 152 / 1e-40 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.002G246600 [exp] 151 / 3e-40 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.014G192900 [exp] 113 / 7e-27 AT5G43960 392 / 3e-133 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 110 / 8e-26 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G257000 [exp] 106 / 1e-24 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.011G025500 [exp] 64 / 6e-12 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.003G170800 [exp] 57 / 7e-10 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10036918 pacid=23170985 polypeptide=Lus10036918 locus=Lus10036918.g ID=Lus10036918.BGIv1.0 annot-version=v1.0 ATGGCGGAAGAAGCTGTTCCCACTTTCAATGCTCAGCTGGTGGGCAATGCCTTTGTGGATCAGTACTACAACATACTCTACAAGAACCCTGAATTTATGC ATAAGTTTTACGTCGACTCGAGTGAAGTGAGCCGGCCTGATTCAGATGGCTCCATGTTCTCCGCCTCCACAATGACTGGCATCAACGACCTGATCCTTTC ATTGGATTACAAAGACTGCGAGGTTCAGATTCTGACAGCTGATGCTCAAAAATCTTTTGGGGGTGGAGTTATCGTTCTGGTTACTGGTTTCCTCACTGGG AAGGACGAGATAAGAAGAATGTTTACCCAATTGTTCTTTTTGGCTCCACAACCAGATAATGGGTTCTTTGTCTTGAATGATGTTCTGAGATACGTGGAAG AAGAGGAGCTGTCAACCGTAAAGGTTAGCAATGGTCCAGCTGATTCTGCTCCAGCTGTTGCTGTTACCCCTCCTCCAGTTGTGGAGCCAAACCCCGTCTC TGACAATTCAGTGGTGGAGAAAGAAGCCACCATTTTGGCTGAGGATGTTCCCATCCAACCTAATAATGAAGCTAGTCTTCAGCTGGAGAACCGCAATATT GCGGCTTCCGAGAAAGAGTTTGTACCCAATAATGTGGCTGAGACACCCCAGAGTGTTGCTCCTCCAGCGACAGTAGTTGCAACACGGGAGGCAGATCACA AACCCTCTGAACCAGCTGTTCCTGCTTCTCAGGAGGATGCTTCCAAGAAGTCTTATGCTTCGATTGCGAAGGCATTGAACTTCAAGAACCAACCTTTCCA GCAAAAACCCAAGCCAGTGGTTCGTGCACCCATTCCTGCTGCTACACCAGTGGCAGAGGCTGCACCTGCACCAGCTCCAGCTCCTCGTCCTGCAAGAAGC AATTCCTTAGAGAAGAACAACAATTACACAGTAAAGGGACACTCTATCTTCGTGGCCAATCTGCCCATGGATGCAACCCCTCAACAACTCATTGAGGCTT TCCAGAAATTCGGTACTATCAAGCCCACCGGCGTCCAAGTCAGAAGTTACAAGCAAGAGAAGAATTGCTTCGGATTCGTCGAGTTCGAAACAGCTGCTGC CATGGAGAACGCCCTTCAGGTTGCAACAATAATGATCGGGAACCGTGAAGCTCATATCGAGAAGAAGAAAGCTGGAGGCGAAGGCGGTAGGTTCCCGCCG AGAAGGGGCGGCTTCAGGGAGGACGGCGGTTTCAGAGGCGGCCGCGGCGGAAACTACGGCGGAGGACGTGGTGGTTATGTGAAGAATGAGTTTGAGAACA ATTACAACGGTCCAGCCAGGGGGCGCAATGTGGAGGGTAACCAGAGAGTGTATCAGAACGGAGGCGGAAGGGGCGGCGGACGTCAATCTAGACCGGCGCC TCAACAAGCTGCTGCGGCGGCCGTCGACGGCGGGGAGAATTAA
AA sequence Show only first row Show all	>Lus10036918 pacid=23170985 polypeptide=Lus10036918 locus=Lus10036918.g ID=Lus10036918.BGIv1.0 annot-version=v1.0 MAEEAVPTFNAQLVGNAFVDQYYNILYKNPEFMHKFYVDSSEVSRPDSDGSMFSASTMTGINDLILSLDYKDCEVQILTADAQKSFGGGVIVLVTGFLTG KDEIRRMFTQLFFLAPQPDNGFFVLNDVLRYVEEEELSTVKVSNGPADSAPAVAVTPPPVVEPNPVSDNSVVEKEATILAEDVPIQPNNEASLQLENRNI AASEKEFVPNNVAETPQSVAPPATVVATREADHKPSEPAVPASQEDASKKSYASIAKALNFKNQPFQQKPKPVVRAPIPAATPVAEAAPAPAPAPRPARS NSLEKNNNYTVKGHSIFVANLPMDATPQQLIEAFQKFGTIKPTGVQVRSYKQEKNCFGFVEFETAAAMENALQVATIMIGNREAHIEKKKAGGEGGRFPP RRGGFREDGGFRGGRGGNYGGGRGGYVKNEFENNYNGPARGRNVEGNQRVYQNGGGRGGGRQSRPAPQQAAAAAVDGGEN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03640			Nuclear transport factor 2 (NT...		Lus10036918 [exp]	0	1
AT5G16390		CAC1-A, BCCP-1,...	BIOTIN CARBOXYL-CARRIER PROTEI...		Lus10004868 [exp]	4.2	0.9516
AT3G04770		RPSAB	40s ribosomal protein SA B (.1...		Lus10013183 [exp]	5.6	0.9552
AT5G60960		PNM1	PPR protein localized to the n...		Lus10034673 [exp]	8.8	0.9504
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10035211 [exp]	10.1	0.9475
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10005441 [exp]	11.8	0.9475
AT3G54470			uridine 5'-monophosphate synth...		Lus10024166 [exp]	12.6	0.9471
AT5G02870			Ribosomal protein L4/L1 family...		Lus10014430 [exp]	15.4	0.9417
AT1G74050			Ribosomal protein L6 family pr...		Lus10039083 [exp]	15.7	0.9504
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10004743 [exp]	15.8	0.9481
AT3G49660		AtWDR5a	human WDR5 \(WD40 repeat\) hom...		Lus10039636 [exp]	15.9	0.9341

Compare expression of checked genes

Lus10036918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.