Lus10036928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26040 106 / 8e-28 HXXXD-type acyl-transferase family protein (.1)
AT3G30280 103 / 8e-27 HXXXD-type acyl-transferase family protein (.1)
AT4G15390 97 / 1e-24 HXXXD-type acyl-transferase family protein (.1)
AT5G47950 91 / 2e-22 HXXXD-type acyl-transferase family protein (.1)
AT5G23970 89 / 2e-21 HXXXD-type acyl-transferase family protein (.1)
AT1G24430 87 / 9e-21 HXXXD-type acyl-transferase family protein (.1)
AT1G24420 79 / 7e-18 HXXXD-type acyl-transferase family protein (.1)
AT4G15400 74 / 3e-16 HXXXD-type acyl-transferase family protein (.1)
AT5G47980 74 / 4e-16 HXXXD-type acyl-transferase family protein (.1)
AT5G57840 58 / 9e-11 HXXXD-type acyl-transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036819 168 / 4e-51 AT3G26040 256 / 1e-80 HXXXD-type acyl-transferase family protein (.1)
Lus10019183 161 / 1e-48 AT3G26040 265 / 3e-84 HXXXD-type acyl-transferase family protein (.1)
Lus10013231 103 / 7e-27 AT3G26040 291 / 5e-94 HXXXD-type acyl-transferase family protein (.1)
Lus10030751 102 / 2e-26 AT3G26040 297 / 2e-96 HXXXD-type acyl-transferase family protein (.1)
Lus10025730 93 / 9e-24 AT4G15390 123 / 2e-32 HXXXD-type acyl-transferase family protein (.1)
Lus10017925 87 / 1e-20 AT3G26040 264 / 1e-83 HXXXD-type acyl-transferase family protein (.1)
Lus10035932 86 / 3e-20 AT1G24430 224 / 3e-68 HXXXD-type acyl-transferase family protein (.1)
Lus10040354 85 / 6e-20 AT3G26040 224 / 1e-67 HXXXD-type acyl-transferase family protein (.1)
Lus10039330 84 / 1e-19 AT3G26040 240 / 2e-74 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G010300 112 / 2e-30 AT3G26040 294 / 2e-95 HXXXD-type acyl-transferase family protein (.1)
Potri.010G053800 108 / 1e-28 AT1G24430 425 / 6e-147 HXXXD-type acyl-transferase family protein (.1)
Potri.010G056450 107 / 3e-28 AT3G26040 350 / 3e-117 HXXXD-type acyl-transferase family protein (.1)
Potri.010G056400 107 / 4e-28 AT3G26040 354 / 5e-119 HXXXD-type acyl-transferase family protein (.1)
Potri.010G054002 106 / 6e-28 AT1G24430 426 / 3e-147 HXXXD-type acyl-transferase family protein (.1)
Potri.010G056300 100 / 6e-26 AT3G26040 347 / 4e-116 HXXXD-type acyl-transferase family protein (.1)
Potri.007G139400 99 / 2e-25 AT3G26040 252 / 7e-80 HXXXD-type acyl-transferase family protein (.1)
Potri.008G180400 96 / 5e-24 AT3G26040 383 / 4e-130 HXXXD-type acyl-transferase family protein (.1)
Potri.002G010700 92 / 7e-23 AT3G26040 306 / 3e-100 HXXXD-type acyl-transferase family protein (.1)
Potri.017G010600 90 / 7e-22 AT3G26040 265 / 3e-84 HXXXD-type acyl-transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0149 CoA-acyltrans PF02458 Transferase Transferase family
Representative CDS sequence
>Lus10036928 pacid=23171236 polypeptide=Lus10036928 locus=Lus10036928.g ID=Lus10036928.BGIv1.0 annot-version=v1.0
ATGAACAATGCAAGAAAACCTGAGGTTTACTCGAGAGAGATGATCAAACCATCTTCCCAAACCCCAACCCACCTCAAAACCCACAAACTGTCCCTATTCG
ACCAATTGGCTCCTCCGATTTACGTCCCTGTCCTCTTCTTCTACCCGCGTCAAGAACCAGTGCGCCCCAATAACACGATCCTGAAAACTTCCCTGCCTTC
GGCGCTAACCAAGTACTACCCTTTAGCCGGAGCAATAAGGGATGATTATGTTGACTGCAACGACGAAGGAGTCGCTTTCCTCCAAGCGCGAACTGACTCG
AAACTGGTCGACGTACTTGAGATTCCAGATGATCAGACCCTAAAGCTCCTCTTCCCGGATGCTCTTTGTTACAAGATACAAAACAGAGCAGCCCCTTGA
AA sequence
>Lus10036928 pacid=23171236 polypeptide=Lus10036928 locus=Lus10036928.g ID=Lus10036928.BGIv1.0 annot-version=v1.0
MNNARKPEVYSREMIKPSSQTPTHLKTHKLSLFDQLAPPIYVPVLFFYPRQEPVRPNNTILKTSLPSALTKYYPLAGAIRDDYVDCNDEGVAFLQARTDS
KLVDVLEIPDDQTLKLLFPDALCYKIQNRAAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G30280 HXXXD-type acyl-transferase fa... Lus10036928 0 1
Lus10027558 1.4 0.8599
AT3G05950 RmlC-like cupins superfamily p... Lus10026962 2.8 0.7987
AT4G31880 unknown protein Lus10026078 12.2 0.8426
AT2G32940 AGO6 ARGONAUTE 6, Argonaute family ... Lus10015155 17.7 0.8040
AT2G36780 UDP-Glycosyltransferase superf... Lus10014403 23.3 0.7177
AT5G20240 MADS PI, PISTILLATA PISTILLATA, K-box region and M... Lus10029719 23.6 0.7969
AT1G69120 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-bo... Lus10034370 26.2 0.7947
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000558 28.1 0.7938
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10022473 30.1 0.7938
AT4G10950 SGNH hydrolase-type esterase s... Lus10023070 31.9 0.7938

Lus10036928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.