Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25070 52 / 4e-09 RIN4 RPM1 interacting protein 4 (.1) AT5G55850 50 / 8e-09 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) AT2G04410 49 / 8e-09 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G40645 44 / 3e-07 RPM1-interacting protein 4 (RIN4) family protein (.1) AT4G35655 44 / 5e-07 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G17660 43 / 1e-06 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G63270 42 / 2e-06 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G48450 42 / 4e-06 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006250 [exp] 111 / 5e-33 AT5G55850 52 / 7e-10 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10006451 [exp] 73 / 2e-17 AT3G25070 46 / 2e-07 RPM1 interacting protein 4 (.1) Lus10011395 [exp] 70 / 5e-15 AT3G26090 624 / 0.0 REGULATOR OF G-PROTEIN SIGNALING 1, G-protein coupled receptors;GTPase activators (.1) Lus10016623 [exp] 49 / 9e-09 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10022524 [exp] 49 / 1e-08 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10025949 [exp] 47 / 4e-08 AT2G17660 87 / 2e-24 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10032112 [exp] 47 / 7e-08 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10012316 [exp] 47 / 7e-08 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10006361 [exp] 46 / 7e-08 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G245400 [exp] 54 / 1e-09 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1) Potri.014G168900 [exp] 49 / 5e-09 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.011G094200 [exp] 50 / 7e-09 AT5G55850 123 / 8e-38 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.001G368900 [exp] 49 / 8e-09 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.001G338500 [exp] 45 / 1e-07 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.015G089201 [exp] 45 / 3e-07 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.012G092601 [exp] 45 / 3e-07 AT2G04410 78 / 3e-20 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.011G022000 [exp] 45 / 1e-06 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1) Potri.004G002500 [exp] 44 / 4e-06 AT3G25070 75 / 1e-16 RPM1 interacting protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [flax] [poplar] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Lus10036939 pacid=23171065 polypeptide=Lus10036939 locus=Lus10036939.g ID=Lus10036939.BGIv1.0 annot-version=v1.0 ATGCTAGAGAAGTTCGGAGGGAGGAGAAGGAAGGAGAGGGAATGGCTGAGGCAAGAAAGGAAGAGGAAGAAGAGGAACAAGAAAATGAAGAGCAATAAGA AGAATGGCAAAGGTAGCAACGATGGAAGCACATTACCGAGGTTCGGGGAATGGGACGAGAACGATCCCTCGTCAGCTGAAGGCTACAGCGCTGTGTTTGA CTTGGTTAGGAAGGAGAAGAACAGTGGTGTTGGCAATATGTCGTTCAAGCTGTTCGATTCAATCAATACCAGGAGGCGGCGAAGCAGGCTCCGTAATTTC CTCAAATCGTTGAAGGTAATGTCTTAA
AA sequence Show only first row Show all	>Lus10036939 pacid=23171065 polypeptide=Lus10036939 locus=Lus10036939.g ID=Lus10036939.BGIv1.0 annot-version=v1.0 MLEKFGGRRRKEREWLRQERKRKKRNKKMKSNKKNGKGSNDGSTLPRFGEWDENDPSSAEGYSAVFDLVRKEKNSGVGNMSFKLFDSINTRRRRSRLRNF LKSLKVMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10036939 [exp]	0	1
AT2G11520		CRCK3	calmodulin-binding receptor-li...		Lus10041796 [exp]	1.4	0.8428
					Lus10033126 [exp]	4.2	0.8121
AT2G44970			alpha/beta-Hydrolases superfam...		Lus10011122 [exp]	5.3	0.7882
AT3G15580		APG8H, ATG8I	AUTOPHAGY 8I, AUTOPHAGY 8H, Ub...		Lus10038046 [exp]	7.3	0.7926
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10031458 [exp]	7.5	0.8071
AT3G22490			Seed maturation protein (.1)		Lus10010553 [exp]	11.6	0.6717
AT1G16040			unknown protein		Lus10015585 [exp]	11.7	0.7832
AT2G24990			Serine/threonine-protein kinas...		Lus10032627 [exp]	11.8	0.8061
AT4G35230		BSK1	BR-signaling kinase 1 (.1)		Lus10003329 [exp]	14.1	0.7781
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10017166 [exp]	14.8	0.8029

Compare expression of checked genes

Lus10036939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.