Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26710 122 / 1e-32 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14610 120 / 7e-32 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14640 118 / 6e-31 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT1G75130 116 / 2e-30 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT3G14660 115 / 9e-30 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14650 114 / 2e-29 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14680 114 / 2e-29 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14690 114 / 2e-29 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14630 111 / 1e-28 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14620 105 / 2e-26 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006245 [exp] 362 / 8e-120 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 339 / 7e-111 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036820 [exp] 284 / 4e-94 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036822 [exp] 211 / 3e-65 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 196 / 6e-60 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10004633 [exp] 191 / 4e-58 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017775 [exp] 189 / 1e-56 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10026681 [exp] 188 / 2e-56 AT3G14620 322 / 4e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10026084 [exp] 180 / 8e-54 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139400 [exp] 213 / 9e-67 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 211 / 3e-66 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 210 / 1e-65 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 206 / 9e-64 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 196 / 4e-60 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 189 / 2e-57 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 155 / 4e-45 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.011G117600 [exp] 125 / 1e-33 AT3G14620 479 / 7e-166 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.017G000600 [exp] 122 / 3e-33 AT1G17060 166 / 1e-46 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) Potri.005G035200 [exp] 121 / 4e-32 AT1G75130 547 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10036943 pacid=23171068 polypeptide=Lus10036943 locus=Lus10036943.g ID=Lus10036943.BGIv1.0 annot-version=v1.0 ATGCTAGGGGATGGACTCGTCGTGCCTAGAGGCGAGAAGTGGACCAAGATGCGCAGGCTCGCCAACCATGCCTTCCACGGAGAAAGCTTGAAGGGTATGG TTCCGGCCATGATCTCGAGCGTGGAGATGATGCTGGAGAGGTGGAAGAAGATGAATGATGGAGACCGGAGAATAGAGATTGATGCATTTCAGGAGTTGAG AATCCTGACAGCCGAAACCATATCCAGGACTGCTTTTCGGAGCAGCTACTTGGAAGGACAAAAGGTTTTCGAGTGGCTGACTAAGATGGTTTCAATCTTC TCGAGGAGCGAGTACAGTGTCAGGATTCCAGGAATCTCGACCATCCTCAGAATTATTTTCAGAAGAGGGGATGGGCATGAATCAGATATTCTCAATCAAG AGATCACAGCCATCATAAAGAACATGGTGGCCAAAAGAGAGAAAGAGAATAACAACAGTAGTTGTGCAACTGATTTCCTTGCATTGCTTCTCAAGGCCTA CACCGATCCTGACATGAAGAAGAGAATCACAGTGGATGATCTGGTTGACGAATGCAAGAGATTCTACTTGGCAGGCCACGAAACCGCCATGAACTCGCTG ACCTGGACACTACTTGCTAGCGGTTAA
AA sequence Show only first row Show all	>Lus10036943 pacid=23171068 polypeptide=Lus10036943 locus=Lus10036943.g ID=Lus10036943.BGIv1.0 annot-version=v1.0 MLGDGLVVPRGEKWTKMRRLANHAFHGESLKGMVPAMISSVEMMLERWKKMNDGDRRIEIDAFQELRILTAETISRTAFRSSYLEGQKVFEWLTKMVSIF SRSEYSVRIPGISTILRIIFRRGDGHESDILNQEITAIIKNMVAKREKENNNSSCATDFLALLLKAYTDPDMKKRITVDDLVDECKRFYLAGHETAMNSL TWTLLASG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10036943 [exp]	0	1

Compare expression of checked genes

Lus10036943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.