Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04070 43 / 2e-05 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G69490 42 / 6e-05 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G61110 41 / 0.0001 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G15510 41 / 0.0001 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT5G07680 40 / 0.0002 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT3G10480 40 / 0.0002 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT5G14000 39 / 0.0005 NAC ANAC084 NAC domain containing protein 84 (.1) AT5G39820 39 / 0.0005 NAC ANAC094 NAC domain containing protein 94 (.1) AT5G61430 39 / 0.0006 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT3G29035 39 / 0.0008 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036959 [exp] 186 / 4e-61 AT3G04070 82 / 8e-19 NAC domain containing protein 47 (.1.2) Lus10037106 [exp] 171 / 4e-55 AT3G04070 78 / 3e-17 NAC domain containing protein 47 (.1.2) Lus10037103 [exp] 79 / 4e-19 AT4G39830 121 / 2e-32 Cupredoxin superfamily protein (.1) Lus10009924 [exp] 79 / 5e-19 AT3G04070 62 / 1e-11 NAC domain containing protein 47 (.1.2) Lus10022914 [exp] 54 / 1e-09 AT1G61110 54 / 7e-09 NAC domain containing protein 25 (.1) Lus10024907 [exp] 53 / 4e-09 AT5G62380 52 / 3e-08 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10037939 [exp] 45 / 4e-06 AT3G10490 415 / 2e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10038670 [exp] 45 / 5e-06 AT3G10490 441 / 5e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10043095 [exp] 45 / 5e-06 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G123500 [exp] 45 / 6e-06 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.010G229700 [exp] 45 / 8e-06 AT3G10480 418 / 8e-144 NAC domain containing protein 50 (.1.2.3) Potri.001G404400 [exp] 44 / 1e-05 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.013G054000 [exp] 44 / 1e-05 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2) Potri.008G089000 [exp] 43 / 2e-05 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.015G020000 [exp] 42 / 4e-05 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1) Potri.010G166200 [exp] 42 / 4e-05 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.019G031400 [exp] 42 / 5e-05 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.004G038000 [exp] 42 / 5e-05 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.012G001400 [exp] 41 / 0.0001 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10036955 pacid=23171090 polypeptide=Lus10036955 locus=Lus10036955.g ID=Lus10036955.BGIv1.0 annot-version=v1.0 ATGAAGATCAAGAACCTAGCAGTAGGGTACCGATTCAAACCATCGGACCAAGAACTAATCCTCACATACCTCTACCCGTTAGCCATCAGAGCCACCGTGA ACCTCAACCACCCTCCTCCGCCCTTCGACGGTATAATCGAGTGCGACCTCTACTCCCCCGACGAGCCATGGAAGAGACACTTCAAGGACGAGGTCAACGA GTCGGAGCTCTACTTCTTCACCAAGCAGAAGAAGAAGAAGAACGAGAAGGGCAAGCGAGTCGATAGGAGCTTCGGAAACTGCATGTGGAAGTCGCAGAAG GAGGAGCCTATAGTCTACAGCACCGACGGCACACCCCCGACGGCGAGTCCACCACCATCGGTTTCGATAGGTCTTTCTCTTACAAGGTCATCAATCACGG TGGTGGTTCGAGTTCGAGTTCTTCTTCGGAGGCTGGGGAATGGGTGA
AA sequence Show only first row Show all	>Lus10036955 pacid=23171090 polypeptide=Lus10036955 locus=Lus10036955.g ID=Lus10036955.BGIv1.0 annot-version=v1.0 MKIKNLAVGYRFKPSDQELILTYLYPLAIRATVNLNHPPPPFDGIIECDLYSPDEPWKRHFKDEVNESELYFFTKQKKKKNEKGKRVDRSFGNCMWKSQK EEPIVYSTDGTPPTASPPPSVSIGLSLTRSSITVVVRVRVLLRRLGNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15510	NAC	ATNAC2, ANAC056...	NAC-REGULATED SEED MORPHOLOGY ...		Lus10036955 [exp]	0	1
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10008454 [exp]	20.9	0.7038
AT1G04910			O-fucosyltransferase family pr...		Lus10030093 [exp]	43.2	0.7554
					Lus10031413 [exp]	61.2	0.6808
AT3G49700		AtACS9, ACS9, E...	ETHYLENE OVERPRODUCING 3, 1-am...		Lus10007714 [exp]	63.9	0.7066
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10020252 [exp]	103.5	0.6701

Compare expression of checked genes

Lus10036955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.