Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04070 61 / 3e-11 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT5G04410 54 / 1e-08 NAC NAC2, ANAC078 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) AT3G15510 52 / 4e-08 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT3G10500 52 / 6e-08 NAC ANAC053 NAC domain containing protein 53 (.1) AT1G69490 51 / 6e-08 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G77450 51 / 8e-08 NAC ANAC032 NAC domain containing protein 32 (.1) AT5G63790 50 / 3e-07 NAC ANAC102 NAC domain containing protein 102 (.1) AT3G10480 49 / 3e-07 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT1G52890 49 / 4e-07 NAC ANAC019 NAC domain containing protein 19 (.1) AT5G07680 49 / 4e-07 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037106 [exp] 266 / 4e-92 AT3G04070 78 / 3e-17 NAC domain containing protein 47 (.1.2) Lus10036955 [exp] 187 / 2e-61 AT3G15510 52 / 2e-08 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10009924 [exp] 105 / 1e-28 AT3G04070 62 / 1e-11 NAC domain containing protein 47 (.1.2) Lus10037103 [exp] 70 / 5e-15 AT4G39830 121 / 2e-32 Cupredoxin superfamily protein (.1) Lus10022914 [exp] 61 / 1e-11 AT1G61110 54 / 7e-09 NAC domain containing protein 25 (.1) Lus10024907 [exp] 57 / 2e-10 AT5G62380 52 / 3e-08 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10023179 [exp] 58 / 5e-10 AT1G61110 248 / 2e-80 NAC domain containing protein 25 (.1) Lus10007410 [exp] 57 / 9e-10 AT3G15510 241 / 1e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10015076 [exp] 56 / 2e-09 AT1G61110 247 / 5e-80 NAC domain containing protein 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G089000 [exp] 56 / 2e-09 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.010G229900 [exp] 55 / 5e-09 AT5G04410 481 / 4e-165 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.002G081000 [exp] 53 / 2e-08 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.008G031800 [exp] 53 / 2e-08 AT5G04410 511 / 6e-177 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.001G404400 [exp] 53 / 2e-08 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.005G180200 [exp] 52 / 2e-08 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123500 [exp] 52 / 4e-08 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.010G229700 [exp] 52 / 4e-08 AT3G10480 418 / 8e-144 NAC domain containing protein 50 (.1.2.3) Potri.004G038000 [exp] 52 / 4e-08 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G046700 [exp] 49 / 3e-07 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10036959 pacid=23171029 polypeptide=Lus10036959 locus=Lus10036959.g ID=Lus10036959.BGIv1.0 annot-version=v1.0 ATGAAGATCAAGAACCTAGCAGTAGGGTACCGATTCAAACCATCGGACCAAGAACTAATCCTCACATACCTCTACCCGTTAGCCATCAGAGCCACCGTCA ACCCCAACCACCCTCCTCCGCCCTTTGACGGTATAATCGAGTGCGACCTCTACTCCCCCGACGAGCCATGGAAGAGACACTTCAAGGACGAGGTCAACGA GTCGGAGCTCTACTTCTTTACCAAGCGGAAGAAGAAGAACGAGAAGGGCAAGCGAGTCGAGAGGAGCTTCGGAAACTGCGTGTGGAAGTCGCAGAAGGAG GAGCCTATAGTCTACAGCACCGACGGTGAGTCCACCACCATCGGTTTCGATAGGTCTTTCTCTTACAAGGTCATCAATCACGGTGGTGGTTCGAGTTCGA GTTCTTCTTCGGAGGCTGGGGAATGGGTGATGCATGAGTATCGTCTTGGTAGGGTTTTGGCGGACAGGTGTGGTGGTGGTATCGAGGACTACGTTATATG TTGCGTGAGGAAGAAGGAAGGTAGCAAGAAGTCATCGTCGGAGTGA
AA sequence Show only first row Show all	>Lus10036959 pacid=23171029 polypeptide=Lus10036959 locus=Lus10036959.g ID=Lus10036959.BGIv1.0 annot-version=v1.0 MKIKNLAVGYRFKPSDQELILTYLYPLAIRATVNPNHPPPPFDGIIECDLYSPDEPWKRHFKDEVNESELYFFTKRKKKNEKGKRVERSFGNCVWKSQKE EPIVYSTDGESTTIGFDRSFSYKVINHGGGSSSSSSSEAGEWVMHEYRLGRVLADRCGGGIEDYVICCVRKKEGSKKSSSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10036959 [exp]	0	1
					Lus10010582 [exp]	1.4	0.8929
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007102 [exp]	1.4	0.8930
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10035625 [exp]	3.9	0.8263
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10041605 [exp]	4.0	0.8350
AT1G15170			MATE efflux family protein (.1...		Lus10002200 [exp]	5.5	0.7107
AT2G25270			unknown protein		Lus10014341 [exp]	6.7	0.8729
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003264 [exp]	10.4	0.6853
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10006971 [exp]	10.6	0.6953
AT3G05060			NOP56-like pre RNA processing ...		Lus10007265 [exp]	11.4	0.7057
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10031437 [exp]	12.6	0.6868

Compare expression of checked genes

Lus10036959 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.